Wikibooks afwikibooks https://af.wikibooks.org/wiki/Tuisblad MediaWiki 1.43.0-wmf.16 first-letter Media Spesiaal Bespreking Gebruiker Gebruikerbespreking Wikibooks Wikibooksbespreking Lêer Lêerbespreking MediaWiki MediaWikibespreking Sjabloon Sjabloonbespreking Hulp Hulpbespreking Kategorie Kategoriebespreking TimedText TimedText talk Module Module talk Main Page 0 1 3240 959 2007-07-23T15:51:41Z 41.241.181.92 #REDIRECT [[Tuisblad]] 3240 wikitext text/x-wiki #REDIRECT [[Tuisblad]] nrctbbcouabanidbepwtp66h9wm03pl MediaWiki:Monobook.js 8 5 4539 3667 2012-08-15T18:58:43Z Ruslik0 363 rm old stuff 4539 javascript text/javascript phoiac9h4m842xq45sp7s6u21eteeq1 Tuisblad 0 917 6832 5231 2021-04-17T00:35:02Z Minorax 2092 obs tag 6832 wikitext text/x-wiki <!-- ╔═════════════════════════════════════════════════════╗ ║ ║ ║ ║ ║ ║ ║ Om vandalisme hok te slaan, is die bewerking ║ ║ van die Voorblad via hierdie blad nie meer ║ ║ moontlik nie. ║ ║ ║ ║ Indien u 'n fout op hierdie blad sien kan u dit ║ ║ op die besprekingsblad uitwys. ║ ║ ║ ║ Daar sal dan so spoedig moontlik daarna gekyk word.║ ║ ║ ║ ║ ╚═════════════════════════════════════════════════════╝ --><!--#### Boks "Inleiding" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}}" align="center">'''Welkom by Wikibooks'''</h2> <div style="border:1px solid #dfdfdf;padding:1em;padding-top:0.5em;"> {{:Tuisblad/Inleiding}} </div> <!--#### Boks "Boekrakke" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}}" align="center">Boekrakke</h2> <div style="margin-bottom:8px; {{:Tuisblad/Styl/Boks}}" align="center"> {{:Tuisblad/Onderwerpe}} |} </div> <!--#### Rechte Spalte #### Beachte: Rechte plus linke Spalte sollten zusammen 98% ergeben --> <div style="width: 55%; float: right; height: 200px;"> <!--#### Box "Empfehlenswerte Bücher" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} margin-top:0;">Aanbevole boeke</h2> <div style="{{:Tuisblad/Styl/Boks}}"> {{:Tuisblad/Aanbevole boeke}} </div> <!--#### Boks "Nuwe Boeke" #### <h2 style="{{:Tuisblad/Styl/Opskrif}}">Nuwe Boeke</h2> <div style="{{:Tuisblad/Styl/Boks}}"> {{:Tuisblad/Nuwe boeke}} </div>--> <!--#### Linke Spalte ####--> </div> <div style="width: 44%;"> <!--#### Box "Boek van die maand" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} margin-top:0;">Boek van die maand</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: .2em;"> {{:Tuisblad/Boek van die maand}} </div> </div> {{:Tuisblad/Innerlik}} <div style="clear: both; padding-bottom: 0.4em;" ></div> <!--#### Box "Susterprojekte" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} text-align: center;">Susterprojekte</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: 0.2em; padding-right: 0em; height: 10em;"> {{:Tuisblad/Susterprojekte}} </div> <!--#### Box "Impressum" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} text-align: center;">Impressum, Lizenzbestimmungen usw.</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: 0.5em; padding-right: 0em;"> <div class="center"><div style="text-align:center; padding-right:2em;"> [[Wikibooks:Impressum|Impressum]]&nbsp;| [[Wikibooks:Lizenzbestimmungen|Lizenzbestimmungen]]&nbsp;| [[Wikibooks:Über Wikibooks|Über Wikibooks]]&nbsp;| [[Wikibooks:Pressespiegel|Presse]] [//wikimediafoundation.org/wiki/Hauptseite Wikimedia Foundation]&nbsp;| [//www.wikimedia.de/ Wikimedia Deutschland e.V.]&nbsp;| [//www.wikimedia.ch/ Wikimedia CH] </div> </div> </div>__NOTOC__ __NOEDITSECTION__ [[ar:]] [[cs:]] [[da:]] [[de:]] [[en:]] [[eo:]] [[es:]] [[fa:]] [[fi:]] [[fr:]] [[he:]] [[hr:]] [[hu:]] [[id:]] [[is:]] [[it:]] [[ja:]] [[ka:]] [[ko:]] [[mk:]] [[nl:]] [[no:]] [[pl:]] [[pt:]] [[ru:]] [[sq:]] [[sv:]] [[ta:]] [[tr:]] [[vi:]] [[zh:]] 6fpke06cc3kp3kiw7rlck2bqfzp72z6 Bespreking:Tuisblad 1 918 6325 6324 2020-02-08T23:48:52Z Hasley 2021 Wysigings deur [[Special:Contributions/31.141.52.58|31.141.52.58]] teruggerol na laaste weergawe deur [[User:Hasley|Hasley]] 4324 wikitext text/x-wiki * '''af:''' * '''en:''' This is the discussion page for the page titled "[[Tuisblad]]". See also [[Wikibooks:Gebruikersportaal|community discussion]]. hallo, 'n paar voorstelle: Eerstens dat die boekrak natuur ingelyf word by Natuurkunde, en dan ook dat religie se naam verander word na Godsdiens. Laastens kan iemand die in eie sake seksie vertaal in Afrikaans, aangesien dit die Afrikaanse wikibooks is en alles verkieslik in Afrikaans moet wees. m6wwzihrula0flgclo4wnj5ffeiy46d Wikibooks 0 919 6655 6653 2020-05-21T10:27:50Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:WhitePhosphorus|WhitePhosphorus]] 4583 wikitext text/x-wiki Wiki books is 'n elektroniese boek wat enigiemand in kan skryf, byvoorbeeld as iemand 'n kookboek geskryf het, kan iemand hulle eie resep bylas of 'n resep verbeter! Jy kan dit doen met enige boek..... [[de:Wikibooks:Über Wikibooks]] [[en:Using Wikibooks]] [[es:Wikilibros:Acerca de]] [[fr:Wikilivres]] [[hu:Wikikönyvek/A Wikikönyvekről]] [[id:Wikibuku:Perihal]] [[it:Usare Wikibooks]] [[ja:Wikibooks:ウィキブックスについて]] [[ka:ვიკიწიგნები:შესახებ]] [[ms:Wikibooks:Perihal]] [[nl:Wikibooks:Info]] [[pl:Wikibooks:O Wikibooks]] [[pt:Wikilivros:Sobre]] [[vi:Wikibooks:Giới thiệu]] b4ozup96gm971df8k93jnfgm9bw9557 Wikibooks:Hoe kan ek bydra 4 920 3308 2508 2007-09-03T14:40:06Z SunbeamDog 33 [[Hoe kan ek bydra]] geskuif na [[Wikibooks:Hoe kan ek bydra]]: edit 3308 wikitext text/x-wiki Hierdie web-bladsye is een van die maklikste plekke op aarde om aan deel te neem. Omtrent 'n dertien-jarige kan help om 'n bladsy te verbeter en om 'n nuwe boek te begin. Jy hoef net op die ''edit'' knoppie bo aan die bladsy te kliek.Dan kan u iets verander, of 'n nuwe boek insit in [[wiki taal]]! gm7nfq64lpo9a3qkskl0fmrqxs1pvj3 Wikibooks:Wie mag deelneem 4 922 3302 1880 2007-09-03T14:37:31Z SunbeamDog 33 [[Wie mag deelneem]] geskuif na [[Wikibooks:Wie mag deelneem]]: Korrekte naamruimte 3302 wikitext text/x-wiki Almal mag deelneem sonder enige kostes of lidmaatskap solank jy weet oor wat jy skryf en [[wiki taal]] kan skryf kan jy deelneem.Moet asb. nie goed met kopie reg publiseer nie .Dit moet van 'n soortgelyke web bladsy soos hierdie af kom en u belowe ons dat u dit self geskryf het . nfglu711xz07hk53x4deti0gftt53fh Esperanto 0 924 7205 7196 2022-12-05T22:02:11Z Kwamikagami 2379 7205 wikitext text/x-wiki <center>[[Image:Flag of Esperanto.svg|frameless|center]] == '''Bonvenon!''' == [[w:Esperanto| Esperanto (Wikipedia)]] [http://www.lernu.net?lingvo=nl Lernu! (Nederlands)] [http://kurso.com.br/index.php?nl Kurso de Esperanto (Nederlands)] [http://kurso.com.br/ Kurso de Esperanto (English)] [[Kategorie:Boeke]] [[Kategorie:Tale]] [[pl:Esperanto/Okładka]] pmf2c19gmu3n8wmf4yaceuk2u175vu8 Gebruiker:Renier Maritz~afwikibooks 2 927 5041 1885 2015-04-16T16:06:28Z Maintenance script 1562 Maintenance script het bladsy [[Gebruiker:Renier Maritz]] na [[Gebruiker:Renier Maritz~afwikibooks]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Renier Maritz|Renier Maritz]]" to... 5041 wikitext text/x-wiki Goeiendag ek is 'n gereelde bydraer by die Afrikaanse wikipedia en beplan om ook binnekort hier 'n groot bydrae te begin lewer. Sien my wikipedia [http://af.wikipedia.org/wiki/Gebruiker:Renier_Maritz gebruikersprofiel] vir meer inligting omtrent myself. ija227mo3za44f5uce9zkn3ty8i7f77 Wikibooks:Administrateurs 4 928 5109 4594 2015-08-09T19:09:44Z YiFeiBot 1614 Verplasing van 32 interwikiskakels wat op [[d:|Wikidata]] beskikbaar is op [[d:q4039395]] 5109 wikitext text/x-wiki ==Versoeke, nominasies vir Sysop regte (Request for sysop rights)== [[Gebruiker:Renier_Maritz]] ==Remove [[Gebruiker:Renier Maritz|Renier Maritz]] from administrator and bureaucrat flags== Please pardon me for speaking no Afrikaans. This bureaucrat is inactive here and elsewhere on Wikimedia after 2008-11-23. [https://toolserver.org/~pathoschild/crossactivity/?user=Renier%20Maritz] I did remind him or her at the [[Gebruikerbespreking:Renier Maritz|talk page]] on 2012-11-22 without any answer, so I suppose that this user has vanished. For the security of your wiki, I would like to kindly propose removing the long inactive administrator and bureaucrat flags. Thanks.--[[Gebruiker:Jusjih|Jusjih]] ([[Gebruikerbespreking:Jusjih|bespreek]]) 15:09, 18 Desember 2012 (UTC) [[cy:Wicillyfrau:Gweinyddwyr]] [[mi:Wikibooks:Administrators]] [[simple:Wikibooks:Administrators]] glcxq9k414ufoiyi5c6dn3fc01kw2bs Gebruikerbespreking:Renier Maritz~afwikibooks 3 929 5068 5040 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5068 wikitext text/x-wiki ==Administrator== Hello, you are now an [[Wikibooks:Administrateurs|administrator]]. I have also made you a bureaucrat so that you can turn other users into sysops. This is done using the [[Special:makesysop]] page. There are instructions on using this at [[m:Bureaucrat]]. If you have any problems, let me know on my [[w:en:User talk:Angela|talk page]], or leave a note on [[meta:Requests for permissions]]. Good luck. [[Gebruiker:Angela|Angela]] 01:15, 1 04 2005 (UTC) == Goeiendag == Hallo Renier, kan jy dit asseblief oorweeg om vir my administrateursregte te gee? Daar is sekere administrateurstake wat uitgevoer moet word (tensy jy dit self wil doen). Ek is Adriaan90 van die Afrikaanse Wikipedia. [[Gebruiker:Adriaan90|Adriaan90]] 11:00, 20 November 2008 (UTC) == Your inactive bureaucrat and sysop flags == Hello. Are you still interested in being a bureaucrat and a sysop on af.wikibooks? You have been inactive after 2008-11-23.--[[Gebruiker:Jusjih|Jusjih]] ([[Gebruikerbespreking:Jusjih|bespreek]]) 10:08, 22 November 2012 (UTC) == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Renier Maritz. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Renier Maritz~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> bslqueqdpowu63r2hq3qbgv8cleil7w Lekker lag grapboek 0 930 6479 6455 2020-02-12T18:22:37Z Meiræ 1408 rv 6479 wikitext text/x-wiki == Tipe grappe == [[Ongeklassifiseerde grappe]] [[Dieetgrappe]] [[Kategorie:Grappe]] 32ci2y7g55y0fsqx3tgy25osoib2hr1 Ongeklassifiseerde grappe 0 931 7393 6665 2024-06-19T06:04:59Z XXBlackburnXx 2010 Revert to revision 3326 dated 2007-09-03 16:16:41 by SunbeamDog using [[:en:Wikipedia:Tools/Navigation_popups|popups]] 7393 wikitext text/x-wiki *Vir my is hansworse nie snaaks nie. Hulle maak my eintlik 'n bietjie bang. Ek het gewonder waar hierdie vrees begin het en ek dink dit was die keer toe ek en my pa sirkus toe gegaan het en hulle my pa doodgemaak het. *Terwyl die lig van rooi na groen na oranje en terug na rooi verander het, het ek oor die lewe gedink. Was dit nie meer as klomp toeters en geskreeu nie? *Ek hoop nie dat `n dier of iets 'n gat in my kop boor en eiers daar in lê nie, want as jy dink jy kry 'n slim idee is dit eintlik die eiers wat uitbroei. *Ek sien 'n wêreld sonder oorlog, sonder haat. Ek sien ons ook die wêreld aanval want hulle sal dit nie verwag nie. *Wanneer jy 'n goeie boek lees is dit as of die outeur saam in die kamer met jou is en met jou praat. Dit is hoekom ek nooit `n goeie boek lees nie. *Wanneer ek ryk word, hoop ek ek word nie aaklig met arm mense nie soos wat ek nou is. *Ek voel nie sleg as ek `n belofte breek nie, ek wonder net hoekom hulle my in die eerste plek geglo het. *Dit is maklik om geld te soek. Dit is waarom ek daarvan hou om net daar sit en niks te doen nie, net die geld te soek. [[Kategorie:Grappe]] ko2dflintcvwmpce817smiz6z0t751q Dieetgrappe 0 932 6775 6773 2020-10-22T19:33:44Z Praxidicae 1951 rvv 3320 wikitext text/x-wiki '''Wanneer kilojoules nie tel nie''' *Wanneer jy iets eet en niemand jou sien nie bevat dit geen kilojoules nie. *Wanneer jy diet coke drink saam met `n sjokolade kanseleer die diet coke die sjokalade se kalorieë uit. *Kos wat gevries is bevat nie kilojoules nie want kilojoules is eenhede van hitte bv. roomys, gevriesde sjokolade, gevriesde pasteie ens. *Kos gebruik vir mediese redes tel nie bv. warm sjokolade roomys, broodjie en kaaskoek. *Stukkie koek tel nie want die afbreekproses gebruik kalorieë. *Kos wat dieselfde kleure het, het ook dieselfde kilojoules bv. spinasie en peppermint roomys; sampioene en wit sjokolade. [[Kategorie:Grappe]] sgsnqu3b3w8umqlhc0crje1iklky8wt Dieet grappe 0 933 1891 2005-04-05T11:47:55Z Renier Maritz~afwikibooks 2 Dieet grappe moved to Dieetgrappe 1891 wikitext text/x-wiki #REDIRECT [[Dieetgrappe]] acgccp5fdwr6nf0lmwnevx16bu13hrp Onseker waar dit behoort 0 934 4181 1892 2010-11-26T20:48:12Z Quentinv57 577 fixing double redirect 4181 wikitext text/x-wiki #REDIRECT [[Ongeklassifiseerde grappe]] d6fmiv9a9asuix6s2ym4ojkdhyhu1n2 Lekker lag grap boek 0 935 1893 2005-04-05T11:51:45Z Renier Maritz~afwikibooks 2 Lekker lag grap boek moved to Lekker lag grapboek 1893 wikitext text/x-wiki #REDIRECT [[Lekker lag grapboek]] 6yorix8ul1kycns1dhl8l7mjpy43l61 Gebruiker:Freakazoid~afwikibooks 2 936 5024 1894 2015-04-16T16:06:21Z Maintenance script 1562 Maintenance script het bladsy [[Gebruiker:Freakazoid]] na [[Gebruiker:Freakazoid~afwikibooks]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Freakazoid|Freakazoid]]" to "[[Special:C... 5024 wikitext text/x-wiki Hallo ek is Hans-Albert ek het die hoof bladsy begin en die wat is wiki voorstelle en nog meer opgestel . Ek bly in Suid-Afrika in Secunda en ek is net 13 jaar oud (dit wys net dat enige iemand iets kan doen. As jy enige vra het oor die bladsy of oor hoe om iets te doen dan kan jy my by freakazoid@3market.co.za E-mail . Hans-Albert jy moet hierdie skuif na jou eie gebruikersblad. Skep vir jouself 'n rekening en dan kan jy al jou goed daar bêre. --Renier Maritz 12:21, 5 04 2005 (UTC) hvd9c4m0ygn1lgq75pbmxsa5icq8vc8 Gebruikerbespreking:Freakazoid~afwikibooks 3 937 5056 5023 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5056 wikitext text/x-wiki Hello ou seun. Ek was heel verbaas toe ek sien wat jy al alles hier aangevang het. Ek sal jou net moet leer spel ook :-). Sal vanaand verder met jou gesels - mooi man! --[[Gebruiker:Renier Maritz|Renier Maritz]] 12:14, 30 03 2005 (UTC) == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Freakazoid. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Freakazoid~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> moh4n6otzvdxbkad9dtmewrbo1a7yz0 Sterrekunde 0 1392 6754 6736 2020-07-08T02:52:54Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6475 wikitext text/x-wiki == Wat is sterrekunde? == Sterrekunde, soms ook bekend as ''astronomie'' kan gedefinieer word as die studie van die hemelligame wat insluit die son, planete, komete, newelvlekke en enige iets wat verband hou met die ruimte buite die aarde se atmosfeer. == Eksterne skakels == [http://www.spacewallpapers.net Spacewallpapers.net] Goeie gehalte, en groot verskeidenheid van astronomie fotografie en beelde. [[Kategorie:Natuurkunde]] g4wtfjn4ka15txg3ae4bxcqrxaanxye HTML 0 1455 7219 7215 2023-01-28T17:55:05Z Savh 636 Wysigings deur [[Special:Contributions/2806:2F0:5020:C850:F43F:18F:B0EA:D20E|2806:2F0:5020:C850:F43F:18F:B0EA:D20E]] teruggerol na laaste weergawe deur [[User:2001:1388:18:30A9:EC66:4735:5E68:AE2D|2001:1388:18:30A9:EC66:4735:5E68:AE2D]] 6838 wikitext text/x-wiki = HTML hulp vir die beginner = Baie studente vra die vraag, ''Hoe kan mens 'n Tuisblad vinnig skep deur HTML te gebruik?'' == Wat is HTML == HTML staan vir '''''H'''yper '''T'''ext '''M'''arkup '''L'''anguage'' en dit is 'n eenvoudige taal om teks as hiperteks voor te stel deur gebruik te maak van sekere sleutel woorde of etikette. Al die etikette moet tussen &lt; en &gt; tekens geskryf word en alle etikette moet vergesel word met 'n einde etiket. 'n Einde etiket moet geskryf word as &lt;/...&gt; == Die basiese vorm van 'n HTML dokument == Alle html dokumente het die volgende basiese vorm. <html> <head> </head> <body> </body> </html> Die <nowiki><head></nowiki> seksie sal inligting bevat wat die dokument self beskryf, terwyl die <nowiki><body></nowiki> seksie die inligting bevat wat U wil publiseer. == U eerste HTML dokument == Die volgende is 'n kort, maar geldige HTML dokument wat eenvoudig die sin '''My eerste HTML dokument''' sal skryf. <html> <head> </head> <body> My eerste HTML dokument </body> </html> U kan dit toets deur die teks hierbo in ''Notepad'' in te tik, dit te stoor as ''eerste.html'' en dan ''eerste.html'' in ''Internet Explorer'' oop te maak. == Paragrawe == Om 'n paragraaf te maak, gebruik <nowiki><p></nowiki> gevolg deur die teks wat in die paragraaf moet wees en sluit dit af met <nowiki></p></nowiki>. {|class="wikitable" border="1" |- !HTML kode !Hoe dit lyk |- |<pre> <body> Dit is die eerste paragraaf Dit is die tweede paragraaf </body> </pre> | Dit is die eerste paragraaf Dit is die tweede paragraaf |- | <pre> <body> <p> Dit is die eerste paragraaf </p> <p> Dit is die tweede paragraaf </p> </body> </pre> | <p> Dit is die eerste paragraaf </p> <p> Dit is die tweede paragraaf </p> |} Soos U kan sien het die eerste voorbeeld geen struktuur nie, maar as ons dir <nowiki><p></nowiki> etikette gebruik kan ons die dokument in twee paragrawe deel. == Opskrifte == Opskrifte kan gemaak word deur die <nowiki><h1></nowiki> tot <nowiki><h5></nowiki> etikette te gebruik. {|class="wikitable" border="1" |- !HTML kode !Hoe dit lyk |- |<pre> <body> <h1>Hierdie is 'n hoof opskrif</h1> <h2>Hierdie is 'n kleiner opskrif</h2> <h3>Hierdie opskrif is nog kleiner</h3> <h4>Hierdie opskrif is noooog kleiner</h4> <h5>Hierdie opskrif is nog nog kleiner</h5> </body> </pre> | <h1>Hierdie is 'n hoof opskrif</h1> <h2>Hierdie is 'n kleiner opskrif</h2> <h3>Hierdie opskrif is nog kleiner</h3> <h4>Hierdie opskrif is noooog kleiner</h4> <h5>Hierdie opskrif is nog nog kleiner</h5> |} [[Kategorie:Boeke]] [[Kategorie:Internet]] [[nl:HTML]] qg0bsbcs54e1fse4rzamildz6qj7ppe Gebruiker:Zigger 2 1470 2632 2005-12-01T13:39:47Z Zigger 9 en 2632 wikitext text/x-wiki [[wikipedia:User:Zigger]] gybo516zbujuxv3ot2ofgkubk4v29v0 Gebruikerbespreking:Zigger 3 1471 2633 2005-12-01T13:40:18Z Zigger 9 en 2633 wikitext text/x-wiki [[wikipedia:User talk:Zigger]] omkpwu9k9dg8oak6bie88o15bl1o3wa Gebruiker:Korg 2 1490 3404 2752 2008-06-06T23:38:08Z Korg 12 Vervang bladsyinhoud met '[[m:User:Korg]]' 3404 wikitext text/x-wiki [[m:User:Korg]] 094wtog13qlbuajq5mye7rptj97kkfn Gebruiker:Korg/monobook.js 2 1491 3405 2753 2008-06-06T23:38:47Z Korg 12 3405 javascript text/javascript document.write('<SCRIPT SRC="http://meta.wikimedia.org/w/index.php?title=User:Korg/global.js&action=raw&ctype=text/javascript"><\/SCRIPT>'); b6ucahkooqsve931i2zyz7x5oymu81v Gebruikerbespreking:Gangleri 3 1494 5158 5147 2015-09-17T21:49:04Z Gangleri 13 layout:&nbsp;2015-09-17…b&nbsp;LTR&nbsp;RTL gangleri 5158 wikitext text/x-wiki {| class="float-center" border="0" cellpadding="0" cellspacing="0" style="background:#efefef; color:black" align="center" LANG="en" |- | align="center" colspan="2" | <span dir="ltr" >The phonetic transcription of <span class="nowrap" >«&nbsp;לערי&nbsp;ריינהארט&nbsp;»</span> is <span class="nowrap" LANG="he" >/lɛʁi&nbsp;ʁɑjnhɑʁt/</span> <span class="nowrap" >(leri&nbsp;raynhart).</span></span><br /> <!-- <span dir="ltr" >The phonetic transcription of <span class="nowrap" LANG="he" >«&nbsp;[[s:yi:בייַ מיר ביסטו שיין|בײַ&nbsp;מיר&nbsp;ביסטו&nbsp;שיין]]&nbsp;»</span> is <span class="nowrap" >/bɑj&nbsp;mɪʁ&nbsp;bɪstu&nbsp;ʃɛyn/</span> <span class="nowrap" >([[w:en:Bei Mir Bistu Shein|bay&nbsp;mir&nbsp;bistu&nbsp;sheyn]]).</span><br />&nbsp;</span><br /> --> {{Softredirect|1=testwiki:user talk:{{PAGENAME}}|2=<span dir="ltr" >testwiki:user talk:<span dir="ltr" >{{PAGENAME}}</span></span>}} |- | align="right" | [[image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:Gangleri]] |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' |}<!-- |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:Gangleri]] |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' --> <br clear="all" /> <!-- **only at sandbox subpages** <center dir="ltr" >This page is an '''user sandbox page'''.<br />'''SUBPAGENAME''':&nbsp;'''{{SUBPAGENAME}}'''&nbsp;&ndash; '''[[mediawiki:Sandbox]]''':&nbsp;'''{{int:Sandbox}}'''&nbsp;<sup>[[w:en:mediawiki:Sandbox]]</sup></center> ---- --> <center> : <sup><span dir="ltr" class="plainlinks" >SITENAME: '''{{SITENAME}}'''&nbsp;· '''language:'''&nbsp;{{CONTENTLANG}}:&nbsp;'''[{{fullurl:{{FULLPAGENAME}}|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:{{FULLPAGENAME}}|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}}}#footer #footer]</span></sup><!-- special:version --> : <sup><span dir "ltr" class="plainlinks" >[[special:version|local curent version]]: {{CURRENTVERSION}}&nbsp;· versions&nbsp;at&nbsp;[[b:special:version|b:]]&nbsp;· [[c:special:version|c:]]&nbsp;· [[d:special:version|d:]]&nbsp;·&nbsp;[[testwikidata:special:version|d2:]]&nbsp;· '''[[m:special:version|m:]]'''&nbsp;· [[mw:special:version|mw:]]&nbsp;· [[n:special:version|n:]]&nbsp;· [[q:special:version|q:]]&nbsp;· [[s:special:version|s:]]&nbsp;· '''[[testwiki:special:version|t:]]'''&nbsp;·&nbsp;[[test2wiki:special:version|t2:]]&nbsp;· [[v:special:version|v:]]&nbsp;· [[voy:special:version|voy:]]&nbsp;· [[w:special:version|w:]]&nbsp;· [[wikt:special:version|wikt:]]&nbsp;· [[w:en:special:version|w:en:]]&nbsp;· [[m:special:sitematrix#{{CONTENTLANG}}|m:special:sitematrix#{{CONTENTLANG}}]]&nbsp;· [[template:Wikivar]]&nbsp;·&nbsp;<sup>[[m:template:Wikivar|m:]]&lrm;</sup></span></sup> : <sup><span dir="ltr" class="plainlinks" >'''mediawiki:Sidebar'''&nbsp;'''[{{fullurl:mediawiki:Sidebar|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:mediawiki:Sidebar/en|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:mediawiki:Sidebar/de|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/es|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/fr|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/it|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ru|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/zh|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ar|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/he|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/hi|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/eo|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]</span></sup> : <sup><span dir "ltr" class="plainlinks" >[{{fullurl:special:Preferences}}#top <span dir="ltr" LANG="en" >your]&nbsp;[{{fullurl:special:Preferences|uselang=en}}#top <span dir="ltr" LANG="en" >local preferences]&nbsp;· [{{fullurl:special:Preferences|uselang=de}}#mw-prefsection-personal <span dir="ltr" LANG="de" >Einstellungen</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=es}}#mw-prefsection-rendering <span dir="ltr" LANG="es" >Preferencias</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=fr}}#mw-prefsection-editing <span dir="ltr" LANG="fr" >Préférences</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=it}}#mw-prefsection-rc <span dir="ltr" LANG="it" >Preferenze</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ru}}#mw-prefsection-watchlist <span dir="ltr" LANG="ru" >Настройки</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=zh}}#mw-prefsection-gadgets <span dir="ltr" LANG="zh" >设置</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ar}}#mw-prefsection-betafeatures <span dir="ltr" LANG="ar" >تفضيلات</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=he}}#mw-prefsection-betafeatures <span dir="ltr" LANG="he" >העדפות</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=hi}}#top <span dir="ltr" LANG="hi" >मेरी वरीयताएँ</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=eo}}#top <span dir="ltr" LANG="eo" >Preferoj</span>]</span></sup><!-- user:{{BASEPAGENAME}} --> : <sup><span dir "ltr" class="plainlinks" >user&nbsp;/&nbsp;&lrm;'''<span dir="ltr" >{{ns:2}}</span>'''&lrm;:&nbsp;&lrm;'''<span dir="ltr" >[[user:{{BASEPAGENAME}}|{{BASEPAGENAME}}]]</span>&lrm;'''&nbsp;·&nbsp;[{{SERVER}}/?title=special:ListUsers&limit=1&username={{BASEPAGENAMEE}} rights]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}|all subpages]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}|T]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.css|&lrm;/common.css]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.js|/common.js]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/Archive/previous user page|/previous user page]]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}/Archive|archives]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}/Archive|archived talks]]&nbsp;· [[b:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|b:]]&nbsp;· [[c:user:{{BASEPAGENAME}}|c:]]&nbsp;· [[d:user:{{BASEPAGENAME}}|d:]]&nbsp;·&nbsp;[[testwikidata:user:{{BASEPAGENAME}}|d2:]]&nbsp;· [[m:user:{{BASEPAGENAME}}|m:]]&nbsp;· [[mw:user:{{BASEPAGENAME}}|mw:]]&nbsp;· [[n:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|n:]]&nbsp;· [[q:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|q:]]&nbsp;· [[s:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|s:]]&nbsp;· [[testwiki:user:{{BASEPAGENAME}}|t:]]&nbsp;·&nbsp;[[test2wiki:user:{{BASEPAGENAME}}|t2:]]&nbsp;· [[v:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|v:]]&nbsp;· [[voy:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|voy:]]&nbsp;· [[w:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|w:]]&nbsp;· [[wikt:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|wikt:]]&nbsp;· [[w:en:user:{{BASEPAGENAME}}|w:en:]]&nbsp;·&nbsp;[[w:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[:en:user:{{BASEPAGENAME}}|:en:]]&lrm;</span></sup><!-- special:foobar --> : <sup><span dir "ltr" class="plainlinks" >&nbsp;[{{fullurl:special:WhatLinksHere/{{FULLPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;WLH]&lrm;&nbsp;· [{{fullurl:special:RecentChanges|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;RC]&lrm;&nbsp;· [{{fullurl:special:Logs|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;logs]&lrm;&nbsp;· [{{fullurl:special:WatchList|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;watchlist]&lrm;&nbsp;<sup>[{{fullurl:special:WatchList/edit|uselang=en}}#top <span LANG="en" >&nbsp;edit]</sup>&lrm;&nbsp;· [{{fullurl:special:Contributions/{{BASEPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;ontributions]&lrm;&nbsp;· [[mediawiki:Common.css|'''local'''&nbsp;mediawiki:Common.css]]&nbsp;· [[mediawiki:Common.js|'''local'''&nbsp;mediawiki:Common.js]]&nbsp;· [[mediawiki:Gadgets-definition|'''local'''&nbsp;mediawiki:Gadgets-definition]]&nbsp;· '''[[special:Notifications|local notifications]]'''<br />[[m:user:{{BASEPAGENAME}}/global.css|m:…'''/global.css''']]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}/global.js|m:…'''/global.js''']]&nbsp;·&nbsp;[[special:centralAuth/{{BASEPAGENAMEE}}|'''global'''&nbsp;account&nbsp;information]]&nbsp;· [https://tools.wmflabs.org/guc/?user={{URLENCODE:{{BASEPAGENAME}}|WIKI}} '''global'''&nbsp;user&nbsp;contributions]<!-- &nbsp;· [https://toolserver.org/~River/cgi-bin/count_edits?user={{BASEPAGENAMEE}}&dbname=wikidatawiki_p&machread=1] --></span></sup><!-- PAGEID related links --> : <sup><span dir "ltr" class="plainlinks" >'''PAGEID:'''&nbsp;{{PAGEID}}&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}#top links&nbsp;'''here''']&nbsp;· <sup>[https:{{SERVER}}/?curid={{PAGEID}}&action=purge# purge&nbsp;↺]&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}&action=edit&section=0# section=0]</sup>&nbsp;· '''REVISIONID:'''&nbsp;{{REVISIONID}}&nbsp;· [https:{{SERVER}}/?oldid={{REVISIONID}}# permanent&nbsp;link]&nbsp;· (layout:&nbsp;2015-09-17…b&nbsp;[https://fi.wikipedia.org/?curid=468081#top LTR]&nbsp;[https://ug.wiktionary.org/?curid=5716#top RTL]&nbsp;short)&lrm;</span></sup><!-- testing and validation links related languages / dialects --> : <sup><span dir "ltr" class="plainlinks" >'''testing and validation links:'''&nbsp;[[user:בײַ מיר ביסטו שיין#BiDi_issues|BiDi issues]]&nbsp;· [[user:I18n|gadget issues]]&nbsp;· '''[[#related languages]] / [[#related dialects]]'''&nbsp;· [[/local notes]]</span></sup> </center> ---- <!-- <br clear="all" /> --> __TOC__ == <span dir="ltr" >Welcome&lrm;&nbsp;<span id="Welcome" dir="ltr" >{{PAGENAME}}</span>&nbsp;to&nbsp;<span id="WelcomeToSITENAME" dir="ltr" >{{SITENAME}}</span>!</span> == : [[Gebruiker:Gangleri|Gangleri]] | [[Gebruikerbespreking:Gangleri|T]] | [[m:user:Gangleri|m:]] [//meta.wikimedia.org/wiki/user_talk:Gangleri?action=history Th] | [[m:user talk:Gangleri|T]] 15:24, 7 September 2015 (UTC) : [[Gebruiker:Gangleri|Gangleri]] | [[Gebruikerbespreking:Gangleri|T]] | [[m:user:Gangleri|m:]] [//meta.wikimedia.org/wiki/user_talk:Gangleri?action=history Th] | [[m:user talk:Gangleri|T]] 04:32, 17 September 2015 (UTC) : [[Gebruiker:Gangleri|Gangleri]] | [[Gebruikerbespreking:Gangleri|T]] | [[m:user:Gangleri|m:]] [//meta.wikimedia.org/wiki/user_talk:Gangleri?action=history Th] | [[m:user talk:Gangleri|T]] 21:49, 17 September 2015 (UTC) q8jjusx9x6zzqqabe952060s5kqtwj8 Gebruiker:Gangleri 2 1497 2764 2006-01-01T20:32:16Z Gangleri 13 2764 wikitext text/x-wiki [{{SERVER}}{{localurl:{{NAMESPACE}}:{{PAGENAME}}|action=purge}} ↺] [{{SERVER}}{{localurl:{{NAMESPACE}}:{{PAGENAME}}|oldid={{REVISIONID}}}} rev-ID : {{REVISIONID}}]<br /> [{{SERVER}}{{localurl:special:Prefixindex|from=Gangleri&namespace=2}} special:Prefixindex|from=Gangleri&namespace=2] <br clear="all" /> __NOTOC____NOEDITSECTION__ ===== [[commons:User:Gangleri]] ===== [[Image:Redirect arrow without text.png|left]] ::* '''irc://irc.freenode.net/wikimedia''' ::* [[wikipedia:de:Benutzer:Gangleri]] ::* [[wikipedia:en:User:Gangleri]] ::* [[wikipedia:eo:Vikipediisto:Gangleri]] ::* [[wikipedia:is:Notandi:Gangleri]] ::* [[wikipedia:ro:Utilizator:Gangleri]] ::* [[wikipedia:yi:באַניצער:Gangleri]] ::* '''[[meta:User:Gangleri]]''' [[de:Benutzer:Gangleri]] [[en:User:Gangleri]] [[eo:Vikipediisto:Gangleri]] [[is:Notandi:Gangleri]] [[ro:Utilizator:Gangleri]] [[yi:באַניצער:Gangleri]] lhlfa78gk0u0qxu1rke1ldkfnhhzzsq Gebruiker:Htonl 2 1525 2824 2006-03-19T20:10:59Z Htonl 17 2824 wikitext text/x-wiki Sien [[w:en:User:Htonl]] (my Wikimedia hoofrekening). efe7t351ta5cq67ibpaadgcsz3c6dag Gebruiker:Jannetta 2 1733 3089 2006-09-22T14:46:42Z 195.50.81.249 3089 wikitext text/x-wiki sien my [[w:af:Gebruiker:Jannetta |profiel]] in die Afrikaanse Wikipedia 3acqlk0z7ktdxzv6xfyd59lzyvxp1y9 Gebruiker:Hendrik~afwikibooks 2 1795 5030 3174 2015-04-16T16:06:21Z Maintenance script 1562 Maintenance script het bladsy [[Gebruiker:Hendrik]] na [[Gebruiker:Hendrik~afwikibooks]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Hendrik|Hendrik]]" to "[[Special:CentralAuth/H... 5030 wikitext text/x-wiki Goeiendag ek is 'n gereelde bydraer by die Afrikaanse wikipedia en beplan om ook binnekort hier 'n groot bydrae te begin lewer. Sien my wikipedia gebruikersprofiel[http://af.wikipedia.org/wiki/Gebruiker:Hendrik] vir meer inligting omtrent myself. kqdqu7gsppyeidlodr64lw9w2uo6mi7 Sir Arthur Conan Doyle/Sherlock Holmes 0 1796 6757 6724 2020-07-08T02:52:56Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Wolverène|Wolverène]] 6679 wikitext text/x-wiki <[[Sir Arthur Conan Doyle]] :''For a detailed list of when each story was originally published see http://web.archive.org/20030522191420/geocities.com/sherlockiana/watson/pub_yop.html '' ===[[A Study in Scarlet]]=== ''STUDT'' - 1887 ===[[The Sign of the Four]]=== ''SIGN4'' - 1890 ===The Adventures of Sherlock Holmes=== ''ADVEN'' - 1891-92 *[[A Scandal in Bohemia]] - SCAN *[[The Red-headed League]] - REDH *[[A Case of Identity]] - IDEN *[[The Boscombe Valley Mystery]] - BOSC *[[The Five Orange Pips]] - FIVE *[[The Man with the Twisted Lip]] - TWIS *[[The Adventure of the Blue Carbuncle]] - BLUE *[[The Adventure of the Speckled Band]] - SPEC *[[The Adventure of the Engineer's Thumb]] - ENGR *[[The Adventure of the Noble Bachelor]] - NOBL *[[The Adventure of the Beryl Coronet]] - BERY *[[The Adventure of the Copper Beeches]] - COPP ===The Memoirs of Sherlock Holmes=== ''MEMOI'' - 1893 *[[Silver Blaze]] - SILV *[[The Yellow Face]] - YELL *[[The Stock-broker's Clerk]] - STOC *[[The 'Gloria Scott']] - GLOR *[[The Musgrave Ritual]] - MUSG *[[The Reigate Puzzle]] - REIG *[[The Crooked Man]] - CROO *[[The Resident Patient]] - RESI *[[The Greek Interpreter]] - GREE *[[The Naval Treaty]] - NAVA *[[The Final Problem]] - FINA ===[[The Hound of the Baskervilles]]=== ''HOUND'' - 1902 ===The Return of Sherlock Holmes=== ''RETUR'' - 1905 *[[The Adventure of the Empty House]] - EMPT *[[The Adventure of the Norwood Builder]] - NORW *[[The Adventure of the Dancing Men]] - DANC *[[The Adventure of the Solitary Cyclist]] - SOLI *[[The Adventure of the Priory School]] - PRIO *[[The Adventure of Black Peter]] - BLAC *[[The Adventure of Charles Augustus Milverton]] - CHAS *[[The Adventure of the Six Napoleons]] - SIXN *[[The Adventure of the Three Students]] - 3STU *[[The Adventure of the Golden Pince-Nez]] - GOLD *[[The Adventure of the Missing Three-Quarter]] - MISS *[[The Adventure of the Abbey Grange]] - ABBE *[[The Adventure of the Second Stain]] - SECO ===[[The Valley of Fear]]=== ''VALLE'' - 1915 ===His Last Bow=== ''LASTB'' - 1917 *[[The Adventure of Wisteria Lodge]] - WIST *[[The Adventure of the Cardboard Box]] - CARD *[[The Adventure of the Red Circle]] - REDC *[[The Adventure of the Bruce-Partington Plans]] - BRUC *[[The Adventure of the Dying Detective]] - DYIN *[[The Disappearance of Lady Frances Carfax]] - LADY *[[The Adventure of the Devil's Foot]] - DEVI *[[His Last Bow.- The War Service of Sherlock Holmes]] - LAST ===[[The Casebook of Sherlock Holmes]]=== ''CASEB'' - 1927 *[[The Adventure of the Mazarin Stone]] - MAZA *[[The Problem of Thor Bridge]] - THOR *[[The Adventure of the Creeping Man]] - CREE *[[The Adventure of the Sussex Vampire]] - SUSS *[[The Adventure of the Three Garridebs]] - 3GAR *[[The Adventure of the Illustrious Client]] - ILLU *[[The Adventure of the Three Gables]] - 3GAB *[[The Adventure of the Blanched Soldier]] - BLAN *[[The Adventure of the Lion's Mane]] - LION *[[The Adventure of the Retired Colourman]] - RETI *[[The Adventure of the Veiled Lodger]] - VEIL *[[The Adventure of Shoscombe Old Place]] - SHOS 6zjfeh4cg9aor5hz45pr4n33yc1pnds Nederlands 0 1800 7214 7206 2023-01-04T20:39:50Z Kwamikagami 2379 7214 wikitext text/x-wiki ==Nederlands - Kom ons leer dit!== [[Beeld:Map of the Dutch World.svg|thumb|upright=2|donkerblauw: Nederlands<br />middenblauw: Afrikaans]] Praat jy [[w:Afrikaans|Afrikaans]]? Dan is [[w:Nederlands|Nederlands]] nie moeilik nie, omdat Afrikaans kom van Nederlands. Daar is 23 miljoen mense wat dit praat en dit is die amptelike taal van drie lande: Nederland (met die Nederlandse Antille en Aruba), België en Suriname. # [[Nederlands/Les 1]] - Die klanke # [[Nederlands/Les 2]] - Die persoonlike voornaamwoord # [[Nederlands/Les 3]] - # [[Nederlands/Les 4]] # [[Nederlands/Les 5]] # [[Nederlands/Les 6]] # [[Nederlands/Les 7]] # [[Nederlands/Les 8]] # [[Nederlands/Les 9]] # [[Nederlands/Les 10]] # [[Nederlands/Les 11]] # [[Nederlands/Les 12]] # [[Nederlands/Les 13]] [[Kategorie:Tale]] [[Kategorie:Nederlands]] [[de:Niederländisch]] [[en:Dutch]] [[fr:Néerlandais]] [[he:הולנדית]] [[is:Hollenska]] [[na:Dorerin Eben Eyong]] [[nl:Nederlands]] [[pl:Niderlandzki/Okładka]] o8bp1j2tb0o5btrm1a36t3xmcfqt3c9 Nederlands/Les 1 0 1801 6635 6539 2020-05-21T10:20:53Z Hamish 2161 Reverted 1 edit by [[Special:Contributions/178.243.78.42|178.243.78.42]] ([[User talk:178.243.78.42|talk]]) to last revision by ~riley by [[:m:User:Xiplus/Twinkle|Twinkle]] Global ([[:m:SWMT|SWMT]]) 6635 wikitext text/x-wiki ==Die klanke== Die klanke van Nederlands verskil 'n bietjie van die in Afrikaans, maar daar is ook baie wat hoegenaam nie verskil nie: {| | :b: /b/ ::{{knop|bad}} - bad :d: /d/ ::{{knop|dop}} - dop :f: /f/ ::{{knop|fiets}} - fiets :h: ::{{knop|hoed}} - hoed | :j: /j/ ::{{knop|jas}} - jas :k: /k/ ::{{knop|kaak}} - kaak :l: /l/ ::{{knop|lucht}} - lucht :m: /m/ ::{{knop|man}} - man | :n: /n/ ::{{knop|nest}} - nest :p: /p/ ::{{knop|paus}} - paus :s: /s/ ::{{knop|stop}} - stop :t: /t/ ::{{knop|taart}} - taart |} ;c :Die Nederlandse c word as /k/ uitgepreek in -ca-, -co-, -cu- of as /s/ in -ce- en -ci-. : ''calcium'' - kalsium :Die Nederlandse ch word as die Afrikaanse g uitgespeek (/x/). : ''lach'' - lag ;g :Die Nederlandse g word baie as die Afrikaanse g (/x/) uitgespreek. Talle mense spreek dit nog ''stemhebbend'' uit. In Vlaandere en Suid-Nederland het hulle die ''sagte g'' wat meer palataal is. ;z :In Nederlands is z soos dit in Engels is : ''zebra'' - sebra ;w : In Noord-Nederland is dit soos die Duitse w: tusse die botande en die onderlip. In Vlaandere en Suriname is dit soos in Engels bilabiaal Die ''f'', ''v'' en ''w'' is drie klanke wat verskil in aspirasie en vokalisatie {|class="wikitable" !letter!!asem!!stem!! |- |f||ja||nee||{{knop|fel}} fel |- |v||ja||ja||{{knop|vel}} vel |- |w||nee||ja||{{knop|wel}} wel |} [[en:Dutch/Lesson 1]] [[Kategorie:Nederlands]] 2urx0zzgsqz7gtmbtttxhc5hikl8mns Sjabloon:Delete 10 1807 5116 5112 2015-08-17T18:40:41Z Randykitty 1346 Wikidata 5116 wikitext text/x-wiki {| name="Deletion notice" cellspacing="8" cellpadding="0" style="width:100%; clear:both; margin:0.5em auto; background-color:#fee; border:2px solid #CC0000;" | [[Beeld:Nuvola apps error.png|100px]] | <h2>Hierdie blad is 'n [[Wikiquote:Spoedige verwyderings|kandidaat vir spoedige verwydering]] om die volgende rede:</h2><p>'''{{{1}}}'''</p> As u nie die spoedige verwydering van hierdie blad steun nie, kan u u besware op die [[Bespreking:{{PAGENAME}}|besprekingsblad]] opper. Sien gerus [[Wikibooks:Spoedige verwyderings]] vir redes hoekom bladsye soos hierdie vir spoedige verwydering gemerk word. Onthou om [[Special:Whatlinkshere/{{NAMESPACE}}:{{PAGENAME}}|bladsye wat na hierdie bladsy verwys]] en <span class=plainlinks>[{{SERVER}}{{localurl:{{NAMESPACE}}:{{PAGENAME}}|action=history}} hierdie blad se geskiedenis]</span> na te gaan vóór verwydering. '''Moenie hierdie kennisgewing verwyder nie.''' |}<includeonly>[[Kategorie:Kandidate vir spoedige verwydering]]</includeonly><noinclude>[[Kategorie:Artikelstatussjablone]]{{sjablooninfo|1=Plaas '''<nowiki>{{delete}}</nowiki>''' of '''<nowiki>{{verwyderomdat}}</nowiki>''' om die kennisgewing op die bladsy aan te bring.}} </noinclude> 0oubk3n2jlia1hikuxewyiftwfyml5a Gebruiker:Thogo 2 1808 3446 3204 2008-10-29T01:54:21Z Pathoschild 29 + global user page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3446 wikitext text/x-wiki {| cellpadding="2" style="border-color:#008B45; empty-cells:show;" <!-- Beginn Hauptrahmen --> |- | heigth="2px" bgcolor="#7EC0EE" colspan="2" | |- <!------------ Kopf mit Willkommenstext und der Navileiste ------------> | colspan="2" | <!------ Willkommenstext ------> <span style="text-align:center; font-size:127%; line-height:1.3;"> Welcome to my user page! </span> <br /><br /> My name is Thomas Goldammer, I'm from Leipzig, Germany. I'm a [[m:Stewards|steward]] of the Wikimedia Foundation. I visit this wiki mainly to undo vandalism and put deletion requests on nonsense pages. <br /> {| align="center" style="padding:5px; text-align:center;" |- | width="48%" style="border-bottom:1px dashed #AAA;" | |- | '''«[[m:User talk:Thogo|Discussion]]»''' | [[Special:Emailuser/Thogo|E-Mail]] | [[Special:Contributions/Thogo|Contribs]] <br /> This wiki has '''{{NUMBEROFARTICLES}}''' articles. |- | width="48%" style="border-top:1px dashed #AAA;" | |} |} otnmrah3wrqxuqimic87ero63ehipxt Gebruikerbespreking:Pathoschild 3 1814 4417 4416 2012-02-17T03:52:13Z Pathoschild 29 global user pages 4417 wikitext text/x-wiki {{#babel:en|fr|af-0}}[[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Pathoschild|m:{{ns:3}}:Pathoschild]] 9s5t9popkjfyaoguhwv0tvqi20fzxs5 Gebruiker:Tangotango 2 1819 3239 2007-07-09T03:35:11Z Tangotango 32 Create user page 3239 wikitext text/x-wiki Hello, my name is Tangotango. Find out more about me here: [[m:User:Tangotango]] <div style="float: left; border:solid #CCCCFF 1px; margin: 1px;"> {| cellspacing="0" style="width: 238px; background: #F8F8FF;" | style="width: 45px; height: 45px; background: white; text-align: center; font-size: 14pt;" |[[Image:Broom icon.svg|43px]] | style="font-size:8pt;padding:4pt;line-height:1.25em;" | This user is a member of the<br>[[m:SWMT|'''Small Wiki Monitoring Team''']]. |}</div> c5jldhk3859t0soo33dfwduk8qfrjxa Gebruiker:SunbeamDog 2 1820 7376 3251 2024-05-01T18:20:30Z TenWhile6 2330 TenWhile6 het bladsy [[Gebruiker:Adriaan]] na [[Gebruiker:SunbeamDog]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adriaan|Adriaan]]" to "[[Special:CentralAuth/SunbeamDog|SunbeamDog]]" 3251 wikitext text/x-wiki By [[:w:Wikipedia|Wikipedia]] is ek [[:w:Gebruiker:Adriaan_1|Gebruiker:Adriaan_1]]. Ek sal tien teen een vinniger reageer as daar boodskappe op my [[:w:Gebruikerbespreking:Adriaan_1|besprekingsblad by Wikipedia]] geplaas word. <nowiki>:D</nowiki> 3vmyiamtvuqg4tvt8fb8omj5o34lcit Gebruikerbespreking:SunbeamDog 3 1821 7378 3252 2024-05-01T18:20:30Z TenWhile6 2330 TenWhile6 het bladsy [[Gebruikerbespreking:Adriaan]] na [[Gebruikerbespreking:SunbeamDog]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adriaan|Adriaan]]" to "[[Special:CentralAuth/SunbeamDog|SunbeamDog]]" 3252 wikitext text/x-wiki <!-- Hello :D --> ffp9q93n6ro0gq3oxam5x8pysb3tzl5 Gebruiker:Az1568 2 1823 3254 2007-07-31T03:52:35Z Az1568 34 . 3254 wikitext text/x-wiki [[m:User:Az1568]] <!--Start box sect--> {| name="userboxes" id="userboxes" style="margin-left: 1em; margin-bottom: 0.5em; width: 248px; border: {{{bordercolor|#99B3FF}}} solid 1px; background-color: {{{backgroundcolor|#FFFFFF}}}; color: {{{textcolor|#000000}}}; float: {{{2|{{{align|right}}}}}}; {{{extra-css|}}}" | <div style="text-align: center; font-size: 120%; font-weight: bold;">{{{1|{{{toptext|Userboxes}}}}}}</div> <div style="float: left; border:solid #CCCCFF 1px; margin: 1px;"> {| cellspacing="0" style="width: 238px; background: #F8F8FF;" | style="width: 45px; height: 45px; background: white; text-align: center; font-size: 14pt;" |[[Image:Broom icon.svg|43px]] | style="font-size:8pt;padding:4pt;line-height:1.25em;" | This user is a member of the<br>[[m:SWMT|'''Small Wiki Monitoring Team''']]. |} </div> {{User en}} {{User af-0}} |} <!--End box sect--> ceeto05lf1tlj2bfypgyc30dgqvvxim Gebruikerbespreking:Az1568 3 1824 4177 3255 2010-11-26T20:46:22Z Quentinv57 577 Softredirect 4177 wikitext text/x-wiki {{Softredirect|:m:User talk:Az1568}} ddef2ogl7h71cq5p555s175phfybcr0 Gebruiker:Majorly 2 1826 3259 2007-08-06T17:18:24Z Majorly 35 [[m:User:Majorly|Majorly]] @ Meta 3259 wikitext text/x-wiki [[m:User:Majorly|Majorly]] @ Meta 5ehikxyrt2dlmj176ttugh0nc1m3u7h Wikibooks:Protected pages 4 1828 3269 3268 2007-08-16T10:36:17Z Jon Harald Søby 30 Het [[Wikibooks:Protected pages]] beskerm: protecting spam from recreation [edit=sysop:move=sysop] [cascading] 3269 wikitext text/x-wiki Pages that are protected from recreation. Only administrators may edit this page. * [[W/w/w/index.php]] * [[W/index.php]] * [[W/w/w/w/w/index.php]] 7n3bc231m5uzhzwmo1ta0dyn13uwdy4 Gebruiker:Bastique 2 1831 3283 2007-08-24T19:07:49Z Bastique 38 new user page 3283 wikitext text/x-wiki <div style="border-top:1px solid #ACACAC; border-bottom:1px solid #ACACAC; margin: 0px; margin-bottom: 0.8em; margin-top:0.8em;"> {| width=100% border="0" cellpadding="2" cellspacing="0" style="border-collapse:collapse; background-color:#F9F9F9;" |- valign="top" | width="100%" style="text-align:center" | [[:m:User:Bastique|Meta user page]] | [[:commons:User:Bastique|Commons user page]] | [[Commons:User talk:Bastique|talk page]] |} </div> I am [[:meta:User:Bastique|Cary Bass]], a [[m:Stewards|steward]], and an [[foundation:Current staff|employee of the Wikimedia Foundation]] :''Please use my [[:Commons:User talk:Bastique|Commons Wikipedia talk page]] to leave me messages.'' q82rr917mhqbj58k5zwnqzav574pvmc Gebruikerbespreking:Bastique 3 1832 3284 2007-08-24T19:10:45Z Bastique 38 redirect 3284 wikitext text/x-wiki #REDIRECT[[User:Bastique]] re9pcurfvpz64ol26u4tk2z2d5lysgv Gebruiker:Effeietsanders 2 1833 3286 2007-08-26T12:57:34Z Effeietsanders 39 Nuwe blad: <br clear="all"><center><div style="border: solid #aaa 1px; clear: both; margin: 0 0 1em 1em; font-size: 90%; background: #f9f9f9; width: 350px; padding: 4px; spacing: 0px; text-align:lef... 3286 wikitext text/x-wiki <br clear="all"><center><div style="border: solid #aaa 1px; clear: both; margin: 0 0 1em 1em; font-size: 90%; background: #f9f9f9; width: 350px; padding: 4px; spacing: 0px; text-align:left; float:both;"> <div style="float: left;">[[Image:Metawiki.png|70px]]</div> <div style="margin-left: 80px;">This user has a page on the [[m:Meta|Meta]]-Wiki with </div> <div style="margin-left: 80px;">all his accounts conveniently arranged on: <div style="margin-left: 40px;">'''[[meta:User:Effeietsanders|M:User:Effeietsanders]]'''</div><br> </div></div></center> 9ojyyz7t5hwwkbf4wbkefixzbmbdqiz Gebruiker:Jorunn 2 1835 3289 2007-08-28T09:17:46Z Jorunn 36 Nuwe blad: [[m:user:Jorunn]] 3289 wikitext text/x-wiki [[m:user:Jorunn]] cpnwj5sgjvp3ow36hcftk9e0tasm28i Kategorie:Artikelstatussjablone 14 1836 3292 2007-09-03T14:23:20Z 41.243.16.213 {{Katbeskryf}} 3292 wikitext text/x-wiki {{Katbeskryf}} 30gqazz8320wqa7i57mhhxvk0gzub5x Sjabloon:Sjablooninfo 10 1837 3526 3293 2008-11-20T08:04:20Z Adriaan90 190 vervang met blou weergawe 3526 wikitext text/x-wiki <includeonly>__NOEDITSECTION__ <div style="clear:both; color:grey; text-align:center;"><small>'''Die onderstaande dokumentasie word nie vertoon wanneer die sjabloon geplaas word nie.'''</small></div> <div class="toccolours" style="background: #C3D9FF; border: 2px solid #4096EE;"> {{{1}}} </div></includeonly><noinclude>{{sjablooninfo|1= ;Doel Hierdie sjabloon kan gebruik word om addisionele inligting oor die doel en gebruik van 'n sjabloon op Wikipedia te verskaf. ;Gebruik Die sjabloon moet tussen &lt;noinclude&gt;&lt;/noinclude&gt; geplaas word. Hier is 'n voorbeeld: <pre><nowiki>&lt;noinclude&gt; {{</nowiki>sjablooninfo|1= Uitleg, doel en gebruik van die sjabloon <nowiki>}} &lt;/noinclude&gt;</nowiki></pre> Die volgende opskrifte moet verkieslik altyd gebruik word: *Doel *Gebruik En indien van toepassing, ook: *Standaardwaarde *Verwante sjablone Hierdie opskrifte word begin met 'n kommapunt (;). }}<noinclude> [[Kategorie:Sjablone|Sjablooninfo]] </noinclude> sog90ulutxws9f3sf5fnuceq9id89i0 Sjabloon:Katbeskryf 10 1838 3294 2007-09-03T14:24:58Z 41.243.16.213 +sjabloon 3294 wikitext text/x-wiki {| cellspacing="8" cellpadding="0" style="width:80%; clear:both; margin:0.5em auto; background-color:#C3D9FF; border:2px solid #4096EE;" | [[Beeld:Information_icon.svg|50px]] | <small>Hierdie kategorie bevat die sjabloon '''{{SL|Katbeskryf}}''', wat 'n outomatiese beskrywing van die kategorie byvoeg. Indien u voel dat hierdie beskrywing nie voldoende is nie, of dat dit dalk misleidend is, kan u gerus die sjabloon van die bladsy <span class="plainlinks">[{{SERVER}}{{localurl:{{NAMESPACE}}:{{PAGENAME}}|action=edit}} verwyder]</span> en 'n meer gepaste, omskrywende beskrywing byvoeg.</small> |} {| cellspacing="8" cellpadding="0" style="width:80%; clear:both; margin:0.5em auto; background-color:#e2f2d2; border:2px solid #acce79; text-align:center" | Hierdie kategorie lys bladsye met betrekking tot '''{{PAGENAME}}'''. |}<includeonly>[[Kategorie:Kategorieë met outomatiese beskrywings]]</includeonly><noinclude>[[Kategorie:Sjablone]]{{sjablooninfo|1= Plaas '''<nowiki>{{katbeskryf}}</nowiki>''' in kategorieë om 'n vinnige, elementêre beskrywing te plaas. Slegs van toepassing op kategorieë wat bladsye met aanhalings lys. Dus nie beeldsjablone, ens. nie. Vir kategorieë in hierdie kategorie, sien ''[[:Kategorie:Kategorieë met outomatiese beskrywings]]''.}}</noinclude> d3fby1k23z7jjiso8ec6ahz8kvgzimf Sjabloon:SL 10 1839 3295 2007-09-03T14:25:28Z 41.243.16.213 edit 3295 wikitext text/x-wiki &#123;{[[Sjabloon:{{{1}}}|{{{1}}}]]}}<noinclude>[[Kategorie:Sjablone|Tl]]{{sjablooninfo|1= ==Gebruik== <nowiki>{{Tl|SJABLOONNAAM}}</nowiki> <br> Dit sal 'n maklike skakel na die sjabloon gee. }} </noinclude> dlxuseuvn5ryaqfqwuvtg9jdyfpiibk Kategorie:Sjablone 14 1840 5113 4634 2015-08-09T19:10:25Z YiFeiBot 1614 Verplasing van 34 interwikiskakels wat op [[d:|Wikidata]] beskikbaar is op [[d:q3740]] 5113 wikitext text/x-wiki {{Katbeskryf}} [[Kategorie:Alles]] [[ru:Категория:Викиучебник:Шаблоны]] ob0brieyd61eew53jhpb21p6i86aa87 Kategorie:Kategorieë met outomatiese beskrywings 14 1841 3297 2007-09-03T14:27:34Z 41.243.16.213 {{Katbeskryf}} 3297 wikitext text/x-wiki {{Katbeskryf}} 30gqazz8320wqa7i57mhhxvk0gzub5x Kategorie:Kandidate vir spoedige verwydering 14 1842 7166 7163 2022-02-10T15:09:29Z EN-Jungwon 2374 Reverted 1 edit by [[Special:Contributions/EN-Jungwon|EN-Jungwon]] ([[User talk:EN-Jungwon|talk]]) (TwinkleGlobal) 7166 wikitext text/x-wiki Hierdie kategorie lys alle bladsy wat met die <nowiki>{{skrap}}</nowiki>-sjabloon geëtiketeer is. mi8cmc25g031h3475usul9a8r6p0i6q Kategorie:Tale 14 1843 3301 2007-09-03T14:35:52Z 41.243.16.213 {{Katbeskryf}} 3301 wikitext text/x-wiki {{Katbeskryf}} 30gqazz8320wqa7i57mhhxvk0gzub5x Wie mag deelneem 0 1844 3303 2007-09-03T14:37:31Z SunbeamDog 33 [[Wie mag deelneem]] geskuif na [[Wikibooks:Wie mag deelneem]]: Korrekte naamruimte 3303 wikitext text/x-wiki #REDIRECT [[Wikibooks:Wie mag deelneem]] 8a0gn6iwolerrtok9ogbbwpw5gryn1n Ongeklassifiseer 0 1845 3307 2007-09-03T14:39:40Z SunbeamDog 33 [[Ongeklassifiseer]] geskuif na [[Ongeklassifiseerde grappe]]: Beter naampie 3307 wikitext text/x-wiki #REDIRECT [[Ongeklassifiseerde grappe]] d6fmiv9a9asuix6s2ym4ojkdhyhu1n2 Hoe kan ek bydra 0 1846 3309 2007-09-03T14:40:06Z SunbeamDog 33 [[Hoe kan ek bydra]] geskuif na [[Wikibooks:Hoe kan ek bydra]]: edit 3309 wikitext text/x-wiki #REDIRECT [[Wikibooks:Hoe kan ek bydra]] tr01alv8wq8kfstvh68imbher4uy1zt Kategorie:Grappe 14 1847 3313 2007-09-03T14:42:11Z SunbeamDog 33 {{Katbeskryf}} 3313 wikitext text/x-wiki {{Katbeskryf}} 30gqazz8320wqa7i57mhhxvk0gzub5x Kategorie:Internet 14 1848 3608 3315 2008-11-20T12:52:06Z Adriaan90 190 [[Kategorie:Rekenaartoepassingstegnologie]] 3608 wikitext text/x-wiki {{Katbeskryf}} [[Kategorie:Rekenaartoepassingstegnologie]] t4ypiqv3saq9fwoyykv60kv210nzw5m Astronomie 0 1849 3318 2007-09-03T14:44:02Z SunbeamDog 33 [[Astronomie]] geskuif na [[Sterrekunde]]: Verafrikaans 3318 wikitext text/x-wiki #REDIRECT [[Sterrekunde]] 2qfbnx5fzp9ljlcmqdxacgs0gatf9x1 Def wikibook 0 1850 3322 2007-09-03T14:45:38Z SunbeamDog 33 [[Def wikibook]] geskuif na [[Wikibooks]]: edit 3322 wikitext text/x-wiki #REDIRECT [[Wikibooks]] e0otebumr2yddnhez3vbn2lri9wfz39 Kategorie:Natuurkunde 14 1851 3325 2007-09-03T16:12:36Z SunbeamDog 33 {{Katbeskryf}} 3325 wikitext text/x-wiki {{Katbeskryf}} 30gqazz8320wqa7i57mhhxvk0gzub5x Hoe om te gebruik 0 1852 6493 6390 2020-02-12T18:30:21Z Meiræ 1408 Rol weergawe 6390 deur [[Special:Contributions/159.146.18.89|159.146.18.89]] ([[User talk:159.146.18.89|bespreek]]) terug. 6493 wikitext text/x-wiki Hierdie is 'n versameling boeke wat as handleidings dien oor hoe om sekere goed te gebruik. ==Aardrykskunde== *[[Hoe om 'n atlas te gebruik|Atlas]] [[Kategorie:Handleidings]] gmxaj0qvr4an11shiusvliz9ffmz95c Hoe om 'n atlas te gebruik 0 1853 6853 6668 2021-11-12T14:38:39Z Grigoz1 2342 Die nederlandse "niet" na die afrikaanse "nie" verander. 6853 wikitext text/x-wiki {{Wikipedia|Atlas}} 'n '''Atlas''' is 'n versameling kaarte met 'n magdom interessante inligting. Atlasbladsye bevat nie net ruimtelike inligting oor die ligging van plekke nie, maar ook nieruimtelike kenmerke van plekke soos die tale wat mense praat, hul godsdienstige oortuiginge en regeringsvorme, om net 'n paar te noem. Wanneer 'n mens 'n atlas gebruik, kan die volgende wenke jou help om die inligting korrek te vertolk uit die data wat gegee word: *Gebruik die geografiese indeks wat agter in die atlas is. Al die plekname wat in die atlas voorkom, sal in alfabetiese volgorde verskyn. Die bladsynommer waar jy die plek kan opspoor, word ook gegee. Die inskrywings bevat dikwels bykomende inligting soos 'n alfanumeriese verwysing en die breedte- en lengtegraad van die plek. *Lees die titels van die kaarte - dit sal jou sê waaroor die kaart gaan. *Atlasse bevat heelwat tematiese kaarte (kaarte oor verskillende onderwerpe) wat vir jou nuut kan wees. Bestudeer die sleutel wat die simbole verklaar deeglik voordat jy probeer om die kaart te vertolk. [[Kategorie:Aardrykskunde]] rt6sc0q1gsm4urhapy69ifhlaqshkxw Sjabloon:Wikipedia 10 1854 4699 4283 2013-09-02T06:42:29Z Jafeluv 519 fix 4699 wikitext text/x-wiki <div class="noprint" style="clear: both; border: solid #aaa 1px; margin: 0 0 1em 1em; font-size: 90%; background: #f9f9f9; width: 250px; padding: 4px; spacing: 0px; text-align: left; float: right;"> <div style="float: left;">[[Beeld:Wikipedia-logo-v2.svg|50px|none|{{{project}}}]]</div> <div style="margin-left: 60px;">Wikipedia has an article on <div style="margin-left: 10px;">'''''[[:w:{{{1}}}|{{#if:{{{2|}}}|{{{2}}}|{{{1}}}}}]]'''''</div></div></div><noinclude> All you need to do to create a floating box Wikipedia link is insert '''<nowiki>{{Wikipedia}}</nowiki>''' at the end of a page, and the template will do the rest for you. If needed, you can specify the name of the Wikipedia article that is to be linked to, and if need be, the title of the link text to be shown. All of the following formats are valid: ---- *'''<nowiki>{{Wikipedia}}</nowiki>''' - Automatically takes the name from the current LyricWiki page ---- *'''<nowiki>{{Wikipedia|Pain of Salvation}}</nowiki>''' - Used when the Wikipedia Article name and the link text you wish to display are the same, but perhaps different than the name of the current LyricWiki page *'''<nowiki>{{Wikipedia|Article=Pain of Salvation}}</nowiki>''' - Same as the above example ---- *'''<nowiki>{{Wikipedia|Muse (band)|Muse}}</nowiki>''' - Used when the Wikipedia Article name and the link text you wish to display are ''different''. The second division [Muse (band)] tells what the name of the Wikipedia Article is, while the third division [Muse] tells what link text should be displayed. *'''<nowiki>{{Wikipedia|Article=Muse (band)|Title=Muse}}</nowiki>''' Same as the above example [[Kategorie:Sjablone]]</noinclude> dikeodifskwa7ktk3xmug31g9tjqhiz Wikibooks:Nospam 4 1858 3356 3345 2007-10-13T12:51:54Z Magister Mathematicae 41 3356 wikitext text/x-wiki == Pages locked from recreation == * {{:*}} * {{:MediaWiki Talk:Ipb cant unblock}} * {{:MediaWiki Talk:Ipb cant unblock/}} * {{:MediaWiki Talk:Ipb cant unblock/index.php}} * {{:MediaWiki Talk:Ipb cant unblock/w/index.php}} * {{:MediaWiki Talk:Ipb cant unblock/w/w/index.php}} * {{:MediaWiki Talk:Ipb cant unblock/w/w/w/index.php}} * {{:MediaWiki Talk:Ipb cant unblock/w/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/wiki/MediaWiki talk:Ipb already blocked/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/wiki/MediaWiki talk:Ipb already blocked/w/w/w/w/index.php}} * {{:Talk:Main Page/}} * {{:Talk:Main Page/index.php}} * {{:Talk:Main Page/w/index.php}} * {{:Talk:Main Page/w/w/index.php}} * {{:Talk:Main Page/w/w/w/index.php}} * {{:Talk:Main Page/w/w/w/w/index.php}} * {{:Main Page/index.php}} * {{:Main Page/w/index.php}} * {{:Main Page/w/w/index.php}} * {{:Main Page/w/w/w/index.php}} * {{:Main Page/w/w/w/w/index.php}} * {{:Talk:Main Page/w/index.php?title=Main Page/w/index.php}} * {{:index.php}} * {{:W/index.php}} * {{:W/w/index.php}} * {{:W/w/w/index.php}} * {{:W/w/w/w/index.php}} * {{:W/w/w/w/w/w/index.php}} <!-- wiktionaries are case sensitive, but it won't hurt on other wikis, so again: --> * {{:w/index.php}} * {{:w/w/index.php}} * {{:w/w/w/index.php}} * {{:w/w/w/w/index.php}} * {{:w/w/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb expiry invalid}} * {{:MediaWiki talk:Ipb expiry invalid/}} * {{:MediaWiki talk:Ipb expiry invalid/index.php}} * {{:MediaWiki talk:Ipb expiry invalid/w/index.php}} * {{:MediaWiki talk:Ipb expiry invalid/w/w/index.php}} * {{:MediaWiki talk:Ipb expiry invalid/w/w/w/index.php}} * {{:MediaWiki talk:Ipb expiry invalid/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb expiry invalid/w/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/index.php}} * {{:MediaWiki talk:Ipb already blocked/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/w/w/w/w/w/index.php}} * {{:MediaWiki talk:Ipb already blocked/wiki/MediaWiki talk:Ipb already blocked/w/w/index.php}} * {{:Talk:index.php}} * {{:Talk:w/index.php}} * {{:Talk:w/w/index.php}} * {{:Talk:w/w/w/index.php}} * {{:Talk:w/w/w/w/index.php}} * {{:Talk:W/index.php}} * {{:Talk:W/w/index.php}} * {{:Talk:W/w/w/index.php}} * {{:Talk:W/w/w/w/index.php}} * {{:MediaWikibespreking:Ipb already blocked/wiki/MediaWikibespreking:Ipb already blocked/w/w/w/index.php}} cq2kdvfsv0otdihw07s8q5k7t32b12u Gebruiker:Magister Mathematicae 2 1861 4103 3344 2010-07-16T15:25:27Z Dferg 303 [[Gebruiker:Drini]] geskuif na [[Gebruiker:Magister Mathematicae]]: Bladsy is outomaties geskuif met die wysiging van die gebruiker "[[User:Drini|Drini]]" na "[[User:Magister Mathematicae|Magister Mathematicae]]" 4103 wikitext text/x-wiki [[m:User:Drini]], your friendly wikimedia [[m:Stewards|steward]] sfcihnv0kt2e23yhdrjf8g4wimuaqnf Gebruikerbespreking:Jorunn 3 1862 3346 2007-09-29T20:36:34Z Jorunn 36 Nuwe blad: [[m:User talk:Jorunn]] 3346 wikitext text/x-wiki [[m:User talk:Jorunn]] evkf857g608zg618g9s2myerswe978o Gebruiker:MF-Warburg 2 1863 3347 2007-10-04T15:28:24Z MF-Warburg 42 Nuwe blad: [[:m:User:MF-Warburg]] 3347 wikitext text/x-wiki [[:m:User:MF-Warburg]] 81k8lvycfkw3shf3si0ucw4psbk26j0 Hulp:Wikibooks 12 1864 3352 3351 2007-10-07T18:04:22Z 41.243.24.49 edit 3352 wikitext text/x-wiki my dogtertjie soek inligting oor poskoetse of net koetse en ek kry net niks WAAR moet ek soek???? het al by geskiedenis,vervoer en enige plek moontelik gaan kyk en hoekom moet dit sooooo moeilik gemaak word??? ek wil net koetse intik en ten minste n leidraad kry!!! nie n hele ele lange stuk geskiedenis van piet pogenpoel wat toevallig op een gery het nie!!!{{paraf|Wbotha}} :As daar enigiets spesifieks is waarvoor jy soek, is dit beter om by [[:w:|Wikipedia]] te gaan kyk. As die onderwerp nie daar beskikbaar is nie, laat weet gerus die gemeenskap by [[:w:Wikipedia:Geselshoekie|die geselshoekie]].[[Gebruiker:41.243.24.49|41.243.24.49]] 18:03, 7 Oktober 2007 (UTC) fp3uu5yvimakko0adga18ntf5yknmp2 Sjabloon:Paraf 10 1865 3350 2007-10-07T18:03:43Z 41.243.24.49 edit 3350 wikitext text/x-wiki <small>—Die voorafgaande anonieme kommentaar is deur [[Gebruiker:{{{1}}}|{{{1}}}]] gelewer ([[Gebruikerbespreking:{{{1}}}|Bespreking]] • [[Spesiaal:Contributions/{{{1}}}|Bydraes]]) {{{2|}}}.</small> pwemfiukmgw6q2rgu9ga00yh5w9gh3u Gebruiker:DerHexer 2 1867 3368 3357 2007-12-30T00:22:04Z DerHexer 45 m 3368 wikitext text/x-wiki I live in Berlin, Germany, and I'm a [[meta:Stewards|steward]] at meta.wikimedia and a sysop at [[:w:en:User:DerHexer|en.wikipedia]] and at [[:w:de:User:DerHexer|de.wikipedia]]. I'm interested in Latin language, Chemistry and Ancient Greek. My contributions can be found [[Special:Contributions/DerHexer|here]], and sorted by namespace [http://tools.wikimedia.de/~interiot/cgi-bin/Tool1/wannabe_kate?username=DerHexer&site=af.wikibooks.org here]. At the moment I'm fighting vandalism. {| border="0" align="left" style="margin-left:1em; margin-bottom:1em;" width="370px" ! colspan="2" | {| align="center" | | colspan="3" align="center" bgcolor="#FFDEAD" width="370px" | overview |- | bgcolor="#FFDEAD" align="center" |[[Special:Emailuser/DerHexer|e-mail]] | bgcolor="#FFDEAD" align="center" |[[User_talk:DerHexer|talk]] | bgcolor="#FFDEAD" align="center" |[[Special:Contributions/DerHexer|contributions]] |} |- | [[Image:Wikistress3D 2 v3.jpg|170px]] || [[Image:DerHexer.png|200px]] |} <br style="clear:right" /> {| align="right" |<div style="float:left;border:solid #99B3FF 1px;margin:1px;"> <table cellspacing="0" style="width:238px;background:#E0E8FF"><tr> <td style="width:45px;height:45px;background:#99B3FF;text-align:center;font-size:14pt">'''IM'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Jabber: derhexer@jabber.ccc.de <br /> (This is '''not''' an e-mail address!<br />Therefore use [[Special:Emailuser/DerHexer|this]] link, please.) [http://pgpkeys.pca.dfn.de:11371/pks/lookup?op=get&search=0x5C2AE6D7DC7E2EF9 GnuPGP key] <br />Skype: sigmundjaehn<br />ICQ: 281562687</td> </tr></table></div> |} [[de:Benutzer:DerHexer]] [[en:User:DerHexer]] [[es:Usuario:DerHexer]] [[la:Usor:DerHexer]] 0jci5g9ld6egpr57yzzqf6gtqzswaxi Gebruiker:Cbrown1023 2 1869 3364 2007-12-02T05:19:16Z Cbrown1023 48 Nuwe blad: [[m:user:Cbrown1023]] 3364 wikitext text/x-wiki [[m:user:Cbrown1023]] m9wmdsm9iojgepovb0oi0p593qsvhu8 Gebruiker:Dungodung 2 1870 3365 2007-12-18T10:24:49Z Dungodung 51 Nuwe blad: [[m:User:Dungodung]] 3365 wikitext text/x-wiki [[m:User:Dungodung]] fw9jxkkcfput12sq7mvvzqv9smmyigq Gebruiker:Werdan7 2 1871 3369 2008-01-15T03:13:42Z Werdan7 54 Nuwe blad: [[m:user:Werdan7]] 3369 wikitext text/x-wiki [[m:user:Werdan7]] 8nrit81858cbix1lksum0i29k33zhgl Gebruikerbespreking:Werdan7 3 1872 3370 2008-01-15T03:13:47Z Werdan7 54 Nuwe blad: [[m:user talk:Werdan7]] 3370 wikitext text/x-wiki [[m:user talk:Werdan7]] 1j7a3dtkviow832meb2kzq21emoa7g0 Gebruiker:Mike.lifeguard 2 1873 3371 2008-01-21T18:23:16Z Mike.lifeguard 55 Nuwe blad: [[m:user:Mike.lifeguard]] 3371 wikitext text/x-wiki [[m:user:Mike.lifeguard]] 236tx3nphq7zsog8l3lodr172c0su86 Gebruikerbespreking:Mike.lifeguard 3 1874 3372 2008-01-21T18:23:21Z Mike.lifeguard 55 Nuwe blad: [[m:user talk:Mike.lifeguard]] 3372 wikitext text/x-wiki [[m:user talk:Mike.lifeguard]] 0npg285m5u1p4r64p3iegwv4hsktpdj Gebruiker:Adambro 2 1875 3373 2008-01-22T23:51:20Z Adambro 56 Nuwe blad: [[meta:User:Adambro]] 3373 wikitext text/x-wiki [[meta:User:Adambro]] ez9ycc6s9gfke3epzjfo61o6h8hw6vd Gebruiker:SPQRobin 2 1877 3376 2008-02-07T20:42:00Z SPQRobin 57 Nuwe blad: Ek spreek Nederlands als my moedertaal, ek ken al wat Afrikaans maar jy sal nog veel Nederlandse woorde in my Afrikaans vind :-) Sien [[meta:User:SPQRobin]]. 3376 wikitext text/x-wiki Ek spreek Nederlands als my moedertaal, ek ken al wat Afrikaans maar jy sal nog veel Nederlandse woorde in my Afrikaans vind :-) Sien [[meta:User:SPQRobin]]. d3x7qv63ab9qb02teqryevy5vuhtuud Gebruiker:Jj137 2 1878 3383 2008-02-16T17:08:40Z Jj137 61 create 3383 wikitext text/x-wiki [[:en:User:Jj137]] ltibvjyhvcbg7x9bpgf73oab2sydi4f Gebruiker:Carkuni 2 1879 3384 2008-02-28T14:08:53Z Carkuni 63 Nuwe blad: Please see detail indormation [[wikipedia:ja:利用者:Carkuni|Japanese Wikipedia User's page]]. 詳細な自己紹介は、[[wikipedia:ja:利用者:Carkuni|日本語版Wikipediaの利... 3384 wikitext text/x-wiki Please see detail indormation [[wikipedia:ja:利用者:Carkuni|Japanese Wikipedia User's page]]. 詳細な自己紹介は、[[wikipedia:ja:利用者:Carkuni|日本語版Wikipediaの利用者ページ]]をご覧ください。 03cvl600se857ft58m2edrmygyuuqcb Kookboek 0 1880 7178 7151 2022-03-18T07:11:49Z Greg Solta 2382 /* Drankies */ 7178 wikitext text/x-wiki Kookboek bevat 'n lys van resepte. Enigiemand kan 'n resep bydrae. == Slaai == A [[Aartappel slaai]] B [[Blomkool & broccoli slaai]] [[Boontjie slaai]] [[Brokkoli slaai|Broccoli slaai]] E [[Ertjie-lagie slaai]] G [[Gemengde groente slaai]] K [[Kerrie noedelslaai]] == Sop == A [[Aartappel sop]] [[Aartappel sop 2]] B [[Beesstert sop]] [[Beesvleis met Bruin Uiesop]] [[Blaarslaai sop]] [[Blikkies sop]] [[Boontjie sop]] [[Botterskorsie sop]] E [[Ertjie sop]] G [[Groente sop]] L [[Lensie sop]] S [[Sampioen sop]] == Ontbyt == A B [[Bielie Mielie]] == Nagereg == * '''[[Beskuitjies]]''' * '''[[Fudge]]''' * '''[[Koeke]]''' * '''[[Poeding]]''' * '''[[Terte]]''' [[Koeksisters]] [[Oliebol]] [[Piesang Broodjie]] == Drankies == * [[Rooibos Tee - Ice Tea]] * [[Pons]] * [[Skommels]] == Aartappelkoekies == '''BESTANDDELE''': 🔸3 medium aartappels (rou) 🔸12,5 ml koekmeelblom 🔸1 eier, geklits 🔸5 ml sout 🔸40 g kaas, gerasper 🔸Klein ui gerasper '''METODE''': Skrop, skil en rasper die aartappels en meng met die ander bestanddele. Verhit `n klein bietjie olie of vet in ń pan en braai lepelsvol van die mengsel totdat die koekies aan albei kante ligbruin is. [[Kategorie:Boeke]] 9be9p6hgs2yngn6scycy1dc47y2v2b5 Gebruiker:Manecke 2 1881 4768 3824 2013-11-14T02:06:14Z CommonsDelinker 24 Administrateur [[commons:user:Sven Manguard|Sven Manguard]] vervang "Wikiversity-logo.png" met "Graduation_cap.png" omrede: [[commons:COM:FR|File renamed]]: This is a misleading name, as the actual Wikiversity logo looks very different from this (see [... 4768 wikitext text/x-wiki <center><nowiki>{{ Babel | de | en-3 | es-1 | fr-3 | it-1 | nl-1 | pt-1 | ru-3 }}</nowiki></center><br> <center>••••••••</center><br> <center><font style="color:black">[mailto:wikimedia@freemail.ru // E-mail]</font> (Betreff: ''Wikimedia'') '''¤''' <font style="color:black">[http://www.icq.com/whitepages/wwp.php?uin=368497744 // ICQ]</font> (UIN: ''368497744'') '''¤''' <font style="color:black">[irc://chat.freenode.net/wikipedia // IRC]</font> (Nick: ''Manecke'')</center><br> <center>••••</center><br> {| style="background-color:#dfeefd; align="center" cellpadding="3px" |- | colspan="14" align="center" bgcolor="#CAD2ff" | '''[[Wikimedia:Home|<nowiki>[[</nowiki> Wikimedia Foundation <nowiki>]]</nowiki>]]''' ([[meta:User:Manecke/Global account|Global account]]) |- align="center" | [[Image:Wikibooks-logo.svg|30px]] | [[Image:Commons-logo.svg|30px]] | [[Image:Incubator-notext.svg|30px]] | [[Image:Wikimania.svg|30px]] | [[Image:Wikimedia Community Logo.svg|30px]] | [[Image:Wikimedia Foundation RGB logo with text.svg|30px]] | [[Image:Wikinews-logo.svg|30px]] | [[Image:Wikiquote-logo.png|30px]] | [[Image:Wikisource-logo.svg|30px]] | [[Image:Graduation_cap.png|30px]] | [[Image:Wikipedia-logo-de.png|30px]] | [[Image:Wiktionary-logo-de.png|30px]] |- bgcolor="#CAD2ff" align="center" font-size:small; | [[de:Benutzer:Manecke|dewikibooks]] | [[commons:User:Manecke|Commons (A)]] | [[incubator:User:Manecke|Incubator]] | [[meta:Wikimania|Wikimania]] | [[meta:IRC|IRC]] | [[meta:User:Manecke|Meta]] | [http://de.wikinews.org/wiki/Benutzer:Manecke de:News] | [http://de.wikiquote.org/wiki/Benutzer:Manecke de:Quote] | [http://de.wikisource.org/wiki/Benutzer:Manecke de:Source] | [http://de.wikiversity.org/wiki/Benutzer:Manecke de:Versity] | [[:de:Benutzer:Manecke|de:Wikipedia (A)]] | [http://de.wiktionary.org/wiki/Benutzer:Manecke de:Tionary] |}<br> <center>••</center> lmvr50s9gpb8pw0yyfohy5m176pw774 Gebruiker:Monobi 2 1882 3387 2008-03-03T03:03:07Z Monobi 65 Nuwe blad: <div style="position:absolute; z-index:100; right:10px; top:10px;" class="metadata" id="Monobi"><div style="position:relative; width: 20px; height: 20px; overflow:hidden;"><div style="pos... 3387 wikitext text/x-wiki <div style="position:absolute; z-index:100; right:10px; top:10px;" class="metadata" id="Monobi"><div style="position:relative; width: 20px; height: 20px; overflow:hidden;"><div style="position:absolute; font-size: 20px; overflow:hidden; line-height: 20px; letter-spacing: 20px;">[[m:User:Monobi/matrix|<span title="Wikimedian user" style="text-decoration:none;">&nbsp; &nbsp;</span>]]</div>[[Image:Wikimedia Community Logo.svg|20px|Wikimedia Community Logo.svg]]</div></div> <div style="background-color: #f6f6f6; padding: 1px; width: 100%; border: 1px solid #aaa; -moz-border: 6px; margin-bottom: 5px;"> <div align="center" style="letter-spacing: 1px;">[[User:Monobi|user page]] '''[[n:es:User:Monobi|<span style="color: #666;">||</span>]]''' [[User talk:Monobi|talk page]]</div> <div align="center" style="letter-spacing: 2px; font-size: 90%; color: #666;">• [[m:User:Monobi/matrix|matrix]] •</div> </div> <font face="Verdana,Arial,Helvetica"> <br /><br /> <center>Hi, I'm [[m:user:Monobi|Monobi]]. I speak en & es-1/2.</center> qj4ycjer9x7fi1v4ujack8qgnrpof4r Gebruiker:EVula 2 1883 3388 2008-03-19T16:09:29Z EVula 67 standardizing userpage 3388 wikitext text/x-wiki {{User:EVula/header}} <div style="float: right; border: 1px solid #ccc; padding: 3px; background: #f6f6f6; margin-left: 10px;"> <div style="border:solid #BDBDAD 1px; margin: 3px 1px;"> {| cellspacing="0" style="width: 238px; background: #fff; margin-left: 0;" | style="width: 45px; height: 45px; background: #BDBDAD; text-align: center;" | '''[[Image:Admin mop.PNG|43x43px|EVula's mop is named "Vera"]]''' | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; color: black;" | This user is an '''[[w:en:Wikipedia:Administrators|administrator]]''' on the [[w:en:English Wikipedia|English Wikipedia]]. <span style="font-size:0.9em;" class="plainlinks">([{{fullurl:w:en:Special:Listusers|limit=1&username=EVula}} <font color="002b88">verify</font>] // [[w:en:User:EVula|user]])</span> |}</div> <div style="border:solid #BDBDAD 1px; margin: 3px 1px;"> {| cellspacing="0" style="width: 238px; background: #fff; margin-left: 0;" | style="width: 45px; height: 45px; background: #BDBDAD; text-align: center;" | '''[[Image:Commons-logo.svg|32px|EVula's mop is named "Vera"]]''' | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; color: black;" | This user is an '''[[Commons:Commons:administrators|administrator]]''' on [[Commons:Main Page|Commons]]. <span style="font-size:0.9em;" class="plainlinks">([{{fullurl:commons:Special:Listusers|limit=1&username=EVula}} <font color="002b88">verify</font>] // [[commons:User:EVula|user]])</span> |}</div> <div style="border: 1px solid #6ef7a7; margin: 3px 1px;"> {| cellspacing="0" style="width:238px;background:#c5fcdc; margin-left: 0;" | style="width:45px;height:45px;background:#6ef7a7;text-align:center;font-size:14pt;" | '''en''' | style="font-size:8pt;padding:4pt;line-height:1.25em;" | This user is a '''native''' speaker of '''[[:w:en:English language|English]]'''. |} </div> {{Gebruiker af-0}} </div> Hi, I'm [[:w:en:User:EVula|EVula]] and you're not. I don't speak Afrikaans; I've just got an account to address interwiki issues when I catch them. [[en:User:EVula]] bk4rf9p0dv5p07q8noqrpuuiogkurbm Gebruiker:EVula/header 2 1884 3389 2008-03-19T16:09:30Z EVula 67 adding standard header 3389 wikitext text/x-wiki <div style="position:absolute; z-index:100; right:10px; top:10px;" class="metadata" id="evulaisfreakinginsane"><div style="position:relative; width: 20px; height: 20px; overflow:hidden;"><div style="position:absolute; font-size: 20px; overflow:hidden; line-height: 20px; letter-spacing: 20px;">[[m:User:EVula/matrix|<span title="[en] As a dedicated Wikimedian, I don't limit myself to just one project or just one language. Viva la wiki revolucion!" style="text-decoration:none;">&nbsp; &nbsp;</span>]]</div>[[Image:Wikimedia Community Logo.svg|20px|Wikimedia Community Logo.svg]]</div></div> <div style="background-color: #f6f6f6; padding: 1px; width: 100%; border: 1px solid #aaa; -moz-border-radius: 6px; margin-bottom: 5px;"> <div align="center" style="letter-spacing: 1px;">[[User:EVula|user page]] '''[[User:EVula/header|<span style="color: #666;">//</span>]]''' [[User talk:EVula|talk page]]</div> <div align="center" style="letter-spacing: 2px; font-size: 90%; color: #666;">• [[m:User:EVula/matrix|matrix]] •</div> </div> aa2fe0lj291t188zfg0aqlza8xz88er Gebruiker:Erkan Yilmaz 2 1885 3390 2008-03-25T10:41:18Z Erkan Yilmaz 69 creation 3390 wikitext text/x-wiki <div style="margin: 0; padding: -27px 0 0 0; float: right; font-size: 100%; text-align: right; line-height: 135%;">{{CURRENTDAYNAME}}, {{CURRENTMONTHNAME}} {{CURRENTDAY}} {{CURRENTYEAR}}, {{CURRENTTIME}} ([[w:UTC|UTC]])</div> {| cellpadding="2" style="background-color:Ivory" align="left" |- | colspan="2" style="text-align:center; background-color:SeaShell" | Links for<br>'''Erkan Yilmaz''' |- style="text-align:center" | style="width:50%" | [[Image:UserIconE-Mail.png]] | style="width:50%" | [[Image:UserIconContributions.png]] |- style="text-align:center" | style="background-color:SeaShell" | [[Special:Emailuser/Erkan_Yilmaz|e-mail]] | style="background-color:SeaShell" | <font color="green">[http://en.wikiversity.org/wiki/User:Erkan_Yilmaz/observations WIKI-Blog]</font> |- |} <br clear="all" style="clear:both;" /> __TOC__ ==wikimedia projects, where I am involved== {|cellpadding="4" cellspacing="0" style="margin: 1em 1em 1em 0; background: #f9f9f9; border: 1px #a0a0a0 solid; border-collapse: collapse; " rules="all" !wikimedia project !English !German |- |[http://en.wikiversity.org/wiki/Wikiversity:Main_Page Wikiversity]<br>[[Image:Microbutton Wikiversity 2 green.gif]] |[http://en.wikiversity.org/wiki/Thucydides:_The_Peloponnesian_War Thucydides: The Peloponnesian War] |[http://de.wikiversity.org/wiki/Kurs:Der_Peloponnesische_Krieg course: "Peloponnesian War"]<br>(Der Peloponnesische Krieg) |- | |[http://en.wikiversity.org/wiki/Romance_of_the_Three_Kingdoms_%28by_Luo_Guanzhong%29 Romance of the Three Kingdoms (by Luo Guanzhong)] |[http://de.wikiversity.org/wiki/Kurs:Die_Geschichte_der_Drei_Reiche_%28von_Luo_Guanzhong%29 Die Geschichte der Drei Reiche (von Luo Guanzhong)] |- | |[http://en.wikiversity.org/wiki/Topic:Software_testing Topic:Software testing] |[http://de.wikiversity.org/wiki/Kurs:Software-Test Kurs:Software-Test] |- |Wikipedia |[[:en:User:Erkan_Yilmaz|user page]] |[[:de:Benutzer:Erkan_Yilmaz|user page]] |} ==Wiki statistics== {|cellpadding="4" cellspacing="0" style="margin: 1em 1em 1em 0; background: #f9f9f9; border: 1px #a0a0a0 solid; border-collapse: collapse; " rules="all" !UTC time of data collection !users !total<br>pages !articles !files !admins !total<br>edits !software version !comment |- |2008-Mrt-25, 10:40 (UTC) |69 |106 |22 |0 |2 |3 |401 |1.13alpha (r32394) |- |{{CURRENTYEAR}}-{{CURRENTMONTHABBREV}}-{{CURRENTDAY2}}, {{CURRENTTIME}} (UTC) |{{NUMBEROFUSERS}} |{{NUMBEROFPAGES}} |{{NUMBEROFARTICLES}} |{{NUMBEROFFILES}} |{{NUMBEROFADMINS}} |{{NUMBEROFEDITS}} |{{CURRENTVERSION}} |} ==leaning mechanisms== {|cellpadding="4" cellspacing="0" style="margin: 1em 1em 1em 0; background: #f9f9f9; border: 1px #a0a0a0 solid; border-collapse: collapse; " rules="all" !German !English !French |- |[[w:de:Habituation|Gewöhnung / Habituation]] |[[w:en:Habituation|habituation]] |[[w:fr:Habituation|habituation]] |- |[[w:de:Klassische Konditionierung|klassische Konditionierung]] |[[w:en:Classical conditioning|classical conditioning]] |[[w:fr:Conditionnement classique|conditionnement classique]] |- |[[w:de:Operante_Konditionierung#Operante_Konditionierung_.28auch:_Instrumentelle_Konditionierung.29|operante Konditionierung]] |[[w:en:Operant conditioning|operant conditioning]] |[[w:fr:Conditionnement opérant|conditionnement opérant]] |- |[[w:de:Spielverhalten|Spielverhalten]] |exploring / game |explorer / jeu |- |Nachahmung -> Lernen d. Beobachtungen |imitation -> learning by observing |imitation -> apprendre par observations |- |Neukombiniertes Verhalten -> [[w:de:Lernen durch Einsicht|Lernen durch Einsicht]] |recombinant behavior -> [[w:en:Cognition|cognitive]] learning |comportement nouveau combiné -> [[w:fr:Cognition|cognitif]] apprentissage |- |[[w:de:Prägung (Verhalten)|Prägung]] |[[w:en:Imprinting (psychology)|imprinting]] |[[w:fr:Empreinte (psychologie)|empreinte]] |- |[[w:de:Tradition|Tradition]] |[[w:en:Tradition|tradition]] |[[w:fr:Tradition|tradition]] |} ==about me== I am working in the IT-business in quality management. Also see my [http://iaskquestions.com blog].<br> The first wiki article I wrote, was kind of much work. I thought at beginning it would take just 30 mins. I had everything prepared in notepad, but there has to be considered many things when writing a wiki-article. And then when I reached the neutrality point, I realized, what I wrote unconsciously in the article. So, lots of work at first, but now with time I get faster :-) Do you think you can not '''change something in the world'''?<br> It is so simple, just remember:<br> if you help someone, this can cause a chain reaction.<br> If everyone, who gets help, helps 3 other people we can change something/quality (not only for software) in the world. examples:<br> [[w:en:Muhammad_Yunus|Muhammad Yunus]] had a small, easy idea, which helped to change the world.<br> Confucius (450BC): "Tell Me and I Will Forget; Show Me and I May Remember; Involve Me and I Will Understand."<br> We can do the same.<br> What is wrong being part of this movement NOW ?<br> '''Just do it!''' geiqhijudljedlvc3ewl3vw1yt3ei55 Gebruikerbespreking:Multichill 3 1886 3391 2008-03-25T18:13:32Z Multichill 80 new talk page 3391 wikitext text/x-wiki {|align=center class="usermessage" width=100% |- |<center>'''Welcome on my talk page, you can also leave a message at my [[nl:Overleg gebruiker:Multichill|Dutch talk page]] for a fast response'''</center> |} 60396fwx7dnuydyt5j4trrxin8g5n3g Gebruiker:Meno25 2 1888 3393 2008-03-27T10:54:45Z Meno25 91 Creating 3393 wikitext text/x-wiki * You can contact me using [[:en:User:Meno25|my English Wikibooks userpage]]. c9fdbvuuzys60pxs3l9rkk9gb9744yt Gebruiker:Mike.lifeguard/monobook.js 2 1890 6812 3456 2021-02-04T23:30:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6812 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Mike.lifeguard/remote.js&action=raw&ctype=text/javascript'); h79pv32wzmk4501fqb6rhkwhkpf0ut9 Gebruiker:MaxSem 2 1892 3399 2008-05-25T15:17:49Z MaxSem 103 Nuwe blad: [[m:User:MaxSem]] 3399 wikitext text/x-wiki [[m:User:MaxSem]] sqs1utsff26npgeq3e2vh3ccsnfg9d7 Gebruiker:Caiaffa 2 1893 3766 3400 2009-08-14T20:38:33Z Caiaffa 147 3766 wikitext text/x-wiki {{babel|pt|en-3|es-2|fr-1|it-1|af-0}} [[w:en:User:Caiaffa]] [[en:User:Caiaffa]] tdsi59wdqqrnixv7fzqm5xy25z2qair Gebruiker:Daniel 2 1894 3401 2008-06-03T05:58:23Z Daniel 140 Nuwe blad: [[Image:Redirectltr.png|#REDIRECT ]]<span class="redirectText" id="softredirect">[[m:User:Daniel]]</span><br /><span style="font-size:85%; padding-left:52px;">The central userpage of the ... 3401 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT ]]<span class="redirectText" id="softredirect">[[m:User:Daniel]]</span><br /><span style="font-size:85%; padding-left:52px;">The central userpage of the [[m:Help:Unified login|global user]] "Daniel" can be viewed at the above link.</span> eatkootvf252ttv01bos89mh3a402iu Gebruikerbespreking:Daniel 3 1895 3402 2008-06-03T06:00:31Z Daniel 140 Nuwe blad: [[Image:Redirectltr.png|#REDIRECT ]]<span class="redirectText" id="softredirect">[[m:User talk:Daniel]]</span><br /><span style="font-size:85%; padding-left:52px;">Please leave any messag... 3402 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT ]]<span class="redirectText" id="softredirect">[[m:User talk:Daniel]]</span><br /><span style="font-size:85%; padding-left:52px;">Please leave any messages on the above-linked talk page.</span> s1glvwi8ctkttjblmavbrc2pzm4a13d Gebruiker:Moe Epsilon 2 1896 5100 4678 2015-07-27T00:05:06Z Ле Лой 1610 SVG 5100 wikitext text/x-wiki {{DISPLAYTITLE:<font face="Segoe Script"><span style="color:royalblue;">Gebruiker:Moe Epsilon</font></span>}} {| align=center style="border:5px solid #D0E7FF; {{Gebruiker:Moe Epsilon/Round corners}}; background:#FFFFFF; -moz-border-radius:15px; padding:5px;" | width=700px valign=top | [[File:Moe Epsilon.png|center|325px]] ---- {| align=center style="font-family:Optima, Trebuchet MS, sans-serif; background:transparent" width="100%" |- align="center" |[[File:Exquisite-Modem.png|100px|link=User talk:Moe Epsilon|My Praatjie Bladsy]] |[[File:Nuvola apps personal.png|70px|link=w:en:User:Moe Epsilon/Biography|My Biografie]] |[[File:Exquisite-kwrite.png|80px|link=Special:Contributions/Moe Epsilon|My Bydraes]] |[[File:Exquisite-kmail3.png|80px|link=Special:EmailUser/Moe Epsilon|My E-pos]] |[[File:Crystal kfm.png|80px|link=w:en:User talk:Moe Epsilon/Archives|My Argiewe]] |[[File:Nuvola apps mozilla.png|80px|link=w:en:User:Moe Epsilon/Barnstars|My Toekennings]] |- align="center" |[[User talk:Moe Epsilon|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Praatjie Bladsy]] |[[w:en:User:Moe Epsilon/Biography|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Biografie</span></span>]] |[[Special:Contributions/Moe Epsilon|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Bydraes</span></span>]] |[[Special:EmailUser/Moe Epsilon|<span style="color:royalblue;"><span style="font-family: Segoe Script">My E-pos</span></span>]] |[[w:en:User talk:Moe Epsilon/Archives|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Argiewe</span></span>]] |[[w:en:User:Moe Epsilon/Barnstars|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Toekennings</span>]] |- align="center" |[[File:Icon tools.png|80px|link=w:en:User:Moe Epsilon/Privileges|My Voorregte]] |[[File:Nuvola_filesystems_www.png|80px|link=Special:CentralAuth/Moe Epsilon|My Globale Rekening]] |[[File:Exquisite-network.png|80px|link=w:en:User:Moe Epsilon/Sitematrix|My Site Matrix]] |[[File:Nuvola apps kcoloredit.png|80px|link=w:en:User:Moe Epsilon/gallery|My Gallery]] |[[File:Baustelle.svg|80px|link=w:en:User:Moe Epsilon/sandbox|My Sandput]] |[[File:Nuvola_apps_korganizer.png|80px|link=w:en:User:Moe Epsilon/Articles|My Skeppings]] |- align="center" |[[w:en:User:Moe Epsilon/Privileges|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Voorregte</span></span>]] |[[Special:CentralAuth/Moe Epsilon|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Globale Rekening</span></span>]] |[[w:en:User:Moe Epsilon/Sitematrix|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Site Matrix</span></span>]] |[[w:en:User:Moe Epsilon/gallery|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Gallery</span></span>]] |[[w:en:User:Moe Epsilon/sandbox|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Sandput</span></span>]] |[[w:en:User:Moe Epsilon/Articles|<span style="color:royalblue;"><span style="font-family: Segoe Script">My Skeppings</span>]] |} <div align="center" style="padding: 4px .2em; word-spacing: 4px; border: 1px solid #A3B1BF;> <inputbox> type=fulltext width=65 searchbuttonlabel=Soek Wikibooks break=no </inputbox></div> |} </br> <div style="background-color: #D0E7FF; {{Gebruiker:Moe Epsilon/Round corners}}; padding: 2px; border: 1px solid #8888aa; margin-top: 3px;" align="center" cellpadding="5" cellspacing="5"> {| style="background: transparent" |style="background: white; border:1px solid #8888aa; {{Gebruiker:Moe Epsilon/Round corners}}; border-right-width:2px; border-bottom-width:2px"|[[File:Moe Epsilon QR code vector.svg|60px|center|Wikipedia]] |style="background: #FFFFFF; border: 1px solid #8888aa; {{Gebruiker:Moe Epsilon/Round corners}}; border-right-width:2px; border-bottom-width:2px; text-align: center;"| ''' <span style="font-family: Segoe Script; font-size: 14pt">Hierdie bladsy is 'n Wikibooks-gebruikerblad</span>'''<br/> <small><span style="font-family: Segoe Script">Hierdie bladsy is nié 'n ensiklopediese artikel nie. As jy hierdie bladsy op enige webwerf anders as Wikibooks aantref, besigtig jy 'n ou spieëlwebruimte. Wees versigtig, aangesien die bladsy verouderd kan wees en die gebruiker geen persoonlike belang in enige ander webwerf, benewens Wikibooks self het nie. Die oorspronklike bladsy is hier geleë: <span class="plainlinks">[http://af.wikibooks.org/wiki/Gebruiker:Moe_Epsilon <span style="color:royalblue;">http://af.wikibooks.org/wiki/Gebruiker:Moe_Epsilon</span>]<br/>[[w:en:SHA-2|<span style="color:royalblue;">SHA-512</span>]]: <small><small>2859e53227 507af76e83fb 570a00da14de1 3ea17c7b2a85485 fb61d868378a8d c9d91509015a05b93 b632ee336648 5a910accff8 8a9e51d407d25 0875dabce7a</small></small></span></small></span> |style="background: white; border:1px solid #8888aa; {{Gebruiker:Moe Epsilon/Round corners}}; border-right-width:2px; border-bottom-width:2px"|[[File:Wikibooks-logo.svg|60px|center|Wikibooks]] |} </div> __NOTOC__ 2oory6g72tyvwlg86mtvbqq91uyftio Gebruiker:MenoBot 2 1897 4683 4183 2013-06-29T14:24:55Z MenoBot 101 r2.7.5) (robot Bygevoeg: [[km:អ្នកប្រើប្រាស់:MenoBot]] 4683 wikitext text/x-wiki This is an interwiki bot operated by [[w:en:User:Meno25|Meno25]]. [[ang:User:MenoBot]] [[ar:مستخدم:MenoBot]] [[az:İstifadəçi:MenoBot]] [[be:Удзельнік:MenoBot]] [[bg:Потребител:MenoBot]] [[bn:ব্যবহারকারী:MenoBot]] [[bs:Korisnik:MenoBot]] [[ca:Usuari:MenoBot]] [[cs:Uživatel:MenoBot]] [[cv:Хутшăнакан:MenoBot]] [[cy:Defnyddiwr:MenoBot]] [[da:Bruger:MenoBot]] [[de:Benutzer:MenoBot]] [[el:Χρήστης:MenoBot]] [[en:User:MenoBot]] [[eo:Uzanto:MenoBot]] [[es:Usuario:MenoBot]] [[et:Kasutaja:MenoBot]] [[eu:Lankide:MenoBot]] [[fa:کاربر:MenoBot]] [[fi:Käyttäjä:MenoBot]] [[fr:Utilisateur:MenoBot]] [[fy:Meidogger:MenoBot]] [[gl:Usuario:MenoBot]] [[he:משתמש:MenoBot]] [[hi:सदस्य:MenoBot]] [[hr:Suradnik:MenoBot]] [[hu:Szerkesztő:MenoBot]] [[hy:Մասնակից:MenoBot]] [[ia:Usator:MenoBot]] [[id:Pengguna:MenoBot]] [[ie:Usator:MenoBot]] [[is:Notandi:MenoBot]] [[it:Utente:MenoBot]] [[ja:利用者:MenoBot]] [[ka:მომხმარებელი:MenoBot]] [[kk:Қатысушы:MenoBot]] [[km:អ្នកប្រើប្រាស់:MenoBot]] [[ko:사용자:MenoBot]] [[ku:Bikarhêner:MenoBot]] [[ky:Колдонуучу:MenoBot]] [[la:Usor:MenoBot]] [[li:Gebroeker:MenoBot]] [[lt:Naudotojas:MenoBot]] [[mg:Mpikambana:MenoBot]] [[mk:Корисник:MenoBot]] [[ml:ഉപയോക്താവ്:MenoBot]] [[mr:सदस्य:MenoBot]] [[ms:Pengguna:MenoBot]] [[ne:प्रयोगकर्ता:MenoBot]] [[nl:Gebruiker:MenoBot]] [[no:Bruker:MenoBot]] [[oc:Utilizaire:MenoBot]] [[pa:ਵਰਤੌਂਕਾਰ:MenoBot]] [[pl:Wikipedysta:MenoBot]] [[pt:Utilizador:MenoBot]] [[ro:Utilizator:MenoBot]] [[ru:Участник:MenoBot]] [[sa:योजकः:MenoBot]] [[si:පරිශීලක:MenoBot]] [[sk:Redaktor:MenoBot]] [[sl:Uporabnik:MenoBot]] [[sq:Përdoruesi:MenoBot]] [[sr:Корисник:MenoBot]] [[sv:Användare:MenoBot]] [[ta:பயனர்:MenoBot]] [[te:వాడుకరి:MenoBot]] [[tg:Корбар:MenoBot]] [[th:ผู้ใช้:MenoBot]] [[tl:Tagagamit:MenoBot]] [[tr:Kullanıcı:MenoBot]] [[tt:Кулланучы:MenoBot]] [[uk:Користувач:MenoBot]] [[ur:صارف:MenoBot]] [[uz:Foydalanuvchi:MenoBot]] [[vi:Thành viên:MenoBot]] [[zh:User:MenoBot]] [[zh-min-nan:User:MenoBot]] 03lawuzaafrkh7fj0ounkywgifs22bu Gebruiker:CarsracBot 2 1898 4408 4398 2012-02-05T18:07:59Z CarsracBot 180 r2.6.4) (robot Bygevoeg: az, be, bn, bs, ca, cs, cv, el, eo, et, eu, gl, he, hi, hr, hu, ia, id, ie, is, ja, ka, kk, ko, ku, ky, la, lt, mg, mk, ml, mr, ms, ne, no, oc, sa, si, sl, sq, sr, su, sv, ta, te, tg, uk, ur, uz, vi, vo, zh-min-nan 4408 wikitext text/x-wiki ---- ---- Bureaucracy => '''[[Special:Makebot/CarsracBot]]''' / '''[[meta:Steward_requests/Bot_status]]''' *User:CarsracBot is a pure <u>interwiki bot</u>, using PyWikipedia framework! *User:CarsracBot is operated from <u>medium-sized</u> Wikipedias <small>(like li, zea, als, yo)</small> *User:CarsracBot is <u>flagged on several wikis</u>, see '''[[:nl:user:CarsracBot|that list]]'''... ---- ---- [[ab:Участник:CarsracBot]] [[am:User:CarsracBot]] [[an:Usuario:CarsracBot]] [[av:Участник:CarsracBot]] [[bat-smg:Nauduotuos:CarsracBot]] [[bcl:Paragamit:CarsracBot]] [[br:Implijer:CarsracBot]] [[cbk-zam:Usuario:CarsracBot]] [[ceb:User:CarsracBot]] [[cu:По́льꙃєватєл҄ь:CarsracBot]] [[diq:User:CarsracBot]] [[eml:Utente:CarsracBot]] [[ext:User:CarsracBot]] [[fiu-vro:Pruukja:CarsracBot]] [[frp:Utilisator:CarsracBot]] [[fur:Utent:CarsracBot]] [[gan:User:CarsracBot]] [[hif:User:CarsracBot]] [[hsb:Wužiwar:CarsracBot]] [[ig:User:CarsracBot]] [[jbo:User:CarsracBot]] [[jv:Panganggo:CarsracBot]] [[kab:Amseqdac:CarsracBot]] [[ksh:Metmaacher:CarsracBot]] [[lij:Utente:CarsracBot]] [[lmo:Utente:CarsracBot]] [[map-bms:Panganggo:CarsracBot]] [[mdf:User:CarsracBot]] [[myv:User:CarsracBot]] [[nap:Utente:CarsracBot]] [[nds-nl:Gebruker:CarsracBot]] [[new:छ्येलेमि:CarsracBot]] [[nrm:User:CarsracBot]] [[nv:Choinish'įįhí:CarsracBot]] [[os:Архайæг:CarsracBot]] [[pam:User:CarsracBot]] [[pap:User:CarsracBot]] [[pdc:Benutzer:CarsracBot]] [[roa-tara:User:CarsracBot]] [[sah:User:CarsracBot]] [[scn:Utenti:CarsracBot]] [[sco:User:CarsracBot]] [[sm:User:CarsracBot]] [[sn:User:CarsracBot]] [[srn:Gebruiker:CarsracBot]] [[ss:User:CarsracBot]] [[stq:Benutser:CarsracBot]] [[to:User:CarsracBot]] [[vec:Utente:CarsracBot]] [[vls:Gebruker:CarsracBot]] [[wo:Utilisateur:CarsracBot]] [[zea:Gebruker:CarsracBot]] [[ang:User:CarsracBot]] [[ar:مستخدم:CarsracBot]] [[az:İstifadəçi:CarsracBot]] [[be:Удзельнік:CarsracBot]] [[bg:Потребител:CarsracBot]] [[bn:ব্যবহারকারী:CarsracBot]] [[bs:Korisnik:CarsracBot]] [[ca:Usuari:CarsracBot]] [[cs:Uživatel:CarsracBot]] [[cv:Хутшăнакан:CarsracBot]] [[cy:Defnyddiwr:CarsracBot]] [[da:Bruger:CarsracBot]] [[de:Benutzer:CarsracBot]] [[el:Χρήστης:CarsracBot]] [[en:User:CarsracBot]] [[eo:Uzanto:CarsracBot]] [[es:Usuario:CarsracBot]] [[et:Kasutaja:CarsracBot]] [[eu:Lankide:CarsracBot]] [[fa:کاربر:CarsracBot]] [[fr:Utilisateur:CarsracBot]] [[fy:Meidogger:CarsracBot]] [[gl:Usuario:CarsracBot]] [[he:משתמש:CarsracBot]] [[hi:सदस्य:CarsracBot]] [[hr:Suradnik:CarsracBot]] [[hu:Szerkesztő:CarsracBot]] [[ia:Usator:CarsracBot]] [[id:Pengguna:CarsracBot]] [[ie:Usator:CarsracBot]] [[is:Notandi:CarsracBot]] [[it:Utente:CarsracBot]] [[ja:利用者:CarsracBot]] [[ka:მომხმარებელი:CarsracBot]] [[kk:Қатысушы:CarsracBot]] [[ko:사용자:CarsracBot]] [[ku:Bikarhêner:CarsracBot]] [[ky:User:CarsracBot]] [[la:Usor:CarsracBot]] [[li:Gebroeker:CarsracBot]] [[lt:Naudotojas:CarsracBot]] [[mg:Mpikambana:CarsracBot]] [[mk:Корисник:CarsracBot]] [[ml:ഉപയോക്താവ്:CarsracBot]] [[mr:सदस्य:CarsracBot]] [[ms:Pengguna:CarsracBot]] [[ne:प्रयोगकर्ता:CarsracBot]] [[nl:Gebruiker:CarsracBot]] [[no:Bruker:CarsracBot]] [[oc:Utilizaire:CarsracBot]] [[pa:ਮੈਂਬਰ:CarsracBot]] [[pl:Wikipedysta:CarsracBot]] [[ro:Utilizator:CarsracBot]] [[ru:Участник:CarsracBot]] [[sa:योजकः:CarsracBot]] [[si:පරිශීලක:CarsracBot]] [[sl:Uporabnik:CarsracBot]] [[sq:Përdoruesi:CarsracBot]] [[sr:Корисник:CarsracBot]] [[su:Pamaké:CarsracBot]] [[sv:Användare:CarsracBot]] [[ta:பயனர்:CarsracBot]] [[te:వాడుకరి:CarsracBot]] [[tg:Корбар:CarsracBot]] [[th:ผู้ใช้:CarsracBot]] [[tl:Tagagamit:CarsracBot]] [[uk:Користувач:CarsracBot]] [[ur:صارف:CarsracBot]] [[uz:Foydalanuvchi:CarsracBot]] [[vi:Thành viên:CarsracBot]] [[vo:Geban:CarsracBot]] [[zh:User:CarsracBot]] [[zh-min-nan:User:CarsracBot]] ffbczr4syjcj1uq1mfbn1d1vrsvmoyo Gebruiker:Matasg 2 1899 4088 3409 2010-06-22T22:51:52Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4088 wikitext text/x-wiki [[m:lt:User:Matasg]] 929ngdeg9xk6zb6kkos5k8aa8gz06z9 Gebruiker:Assassingr 2 1900 4178 3410 2010-11-26T20:46:32Z Quentinv57 577 Softredirect 4178 wikitext text/x-wiki {{Softredirect|:el:v:Χρήστης:Assassingr}} ifemo7q1mkj8a5o15qzp3sa8ltanla6 Gebruikerbespreking:MenoBot 3 1901 3411 2008-06-22T13:46:29Z MenoBot 101 talk 3411 wikitext text/x-wiki Please leave comments in English [[w:en:User talk:Meno25|here]]. 71i1b2lidd8zeajwxudf0mudmfh1lfr Gebruiker:Baiji 2 1902 3413 2008-08-11T10:31:31Z Baiji 207 userpage 3413 wikitext text/x-wiki Sien my [[w:es:Usuario:Baiji|profiel]] in die Spaans Wikipedia. smsuqvgakova9aqv9l5qgt83xrj9o5d Gebruiker:Junafani 2 1903 3414 2008-08-11T18:02:29Z Junafani 208 Nuwe blad: [[w:fi:Käyttäjä:Junafani]] 3414 wikitext text/x-wiki [[w:fi:Käyttäjä:Junafani]] 1se1o5e458prjcvnusfzsw30omd9sew Gebruikerbespreking:Spacebirdy 3 1904 3415 2008-08-25T20:44:34Z Spacebirdy 50 . 3415 wikitext text/x-wiki <div style="border:1px solid #638C9C;background-color:#C5D8F3;padding:2px;" class="plainlinks"> <div style="background-color:steelblue;" align="center">[http://meta.wikimedia.org/w/index.php?title=User_talk:Spacebirdy&action=edit&section=new <font color="white">Nýtt spjall</font>] </div> <div style="border:3px solid slategray;background-color:#616F7C;padding:2px;color:lightsteelblue;" class="plainlinks"> '''Please post messages only here:''' *<span style="background-color:lightsteelblue;padding:3px;">[http://meta.wikimedia.org/wiki/User_talk:Spacebirdy meta: Spacebirdy talk]</span> Thanks. <div style="border:1px solid #638C9C;background-color:lightsteelblue;padding:2px;color:black;"> You can also reach me on IRC: [irc://chat.freenode.net/wiktionary #wiktionary], [irc://chat.freenode.net/wikimedia #wikimedia]<br> </div></div> <!-----------------------------------------------------------------------------------------------------> l2kkzfpb0lo4h8wqvhzqvfuv8b4x1ow Gebruiker:Sir Louis Point du Lac Bot 2 1905 3416 2008-09-14T05:53:03Z Sir Lestaty de Lioncourt 86 + 3416 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Sir Abraham Van Helsing Bot 2 1906 3417 2008-09-14T05:53:08Z Sir Lestaty de Lioncourt 86 + 3417 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Sir Nicholas de Lenfent Bot 2 1907 3418 2008-09-14T05:53:12Z Sir Lestaty de Lioncourt 86 + 3418 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Sir Enkil Bot 2 1908 3419 2008-09-14T05:53:17Z Sir Lestaty de Lioncourt 86 + 3419 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Lady Gabrielle de Lioncourt Bot 2 1909 3420 2008-09-14T05:53:22Z Sir Lestaty de Lioncourt 86 + 3420 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Lady Maharet Bot 2 1910 3421 2008-09-14T05:53:27Z Sir Lestaty de Lioncourt 86 + 3421 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Lady Akasha Bot 2 1911 3422 2008-09-14T05:53:32Z Sir Lestaty de Lioncourt 86 + 3422 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruiker:Lady Lilith Bot 2 1912 3423 2008-09-14T05:53:40Z Sir Lestaty de Lioncourt 86 + 3423 wikitext text/x-wiki {|align=center |[[Image:Lions - melbourne zoo.jpg|470px|center]] |} <div style="background-color: #FFD700; font-size: 1px; height: 7px; border: 1px solid #AAAAAA; margin-top: 10px;"></div> <div style="background-color: #F5F5DC; border: 1px solid #8898BF; border-top: 0px solid white; padding: 5px 5px 0 5px;"> <p>[[Image:Exquisite-opera.png|35px|left]] '''<span style="font-size: 120%;">[[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]]</span>'''<br><span style="font-size: 90%;">'''Menu''' : [[User talk:Sir Lestaty de Lioncourt|Talk page]] | [[Special:Emailuser/Sir Lestaty de Lioncourt|Email]] | [[Special:Contributions/Sir Lestaty de Lioncourt|Contributions]] | [[Special:PrefixIndex/User:Sir Lestaty de Lioncourt|Subpages]] '''Bots''': [[User:Sir Louis Point du Lac Bot|Louis]] | [[User:Sir Nicholas de Lenfent Bot|Nicholas]] | [[User:Sir Abraham Van Helsing Bot|Abraham]] | [[User:Sir Enkil Bot|Enkil]] | [[User:Lady Gabrielle de Lioncourt Bot|Gabrielle]] | [[User:Lady Maharet Bot|Maharet]] | [[User:Lady Akasha Bot|Akasha]] | [[User:Lady Lilith Bot|Lilith]]<br>{{PAGENAME}} is a bot account of [[User:Sir Lestaty de Lioncourt|Sir Lestaty de Lioncourt]], any problem please report for he.</span></p> </div> ia6d7fvqshxufcazv8qvu1xlyte2rkn Gebruikerbespreking:Lady Lilith Bot 3 1913 3424 2008-09-14T05:54:00Z Sir Lestaty de Lioncourt 86 + 3424 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Lady Akasha Bot 3 1914 3425 2008-09-14T05:54:22Z Sir Lestaty de Lioncourt 86 + 3425 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Lady Maharet Bot 3 1915 3426 2008-09-14T05:54:29Z Sir Lestaty de Lioncourt 86 + 3426 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Sir Enkil Bot 3 1916 3427 2008-09-14T05:55:05Z Sir Lestaty de Lioncourt 86 + 3427 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Lady Gabrielle de Lioncourt Bot 3 1917 3428 2008-09-14T05:55:15Z Sir Lestaty de Lioncourt 86 + 3428 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Sir Nicholas de Lenfent Bot 3 1918 3429 2008-09-14T05:55:15Z Sir Lestaty de Lioncourt 86 + 3429 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Sir Abraham Van Helsing Bot 3 1920 3431 2008-09-14T05:55:30Z Sir Lestaty de Lioncourt 86 + 3431 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Sir Louis Point du Lac Bot 3 1921 3432 2008-09-14T05:55:38Z Sir Lestaty de Lioncourt 86 + 3432 wikitext text/x-wiki <div class="usermessage plainlinks"><div class="plainlinks"><span style="text-decoration: ">Please click <font color=002BB8>[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:Sir_Lestaty_de_Lioncourt&action=edit&section=new here]</font></span> for new messages. Thank you.</div></div> j5wxtz8d7rtc467vr2nvgckow96nugt Gebruikerbespreking:Sir Lestaty de Lioncourt 3 1922 4946 3812 2015-01-11T23:01:10Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Sir Lestaty de Lioncourt]]) 4946 wikitext text/x-wiki __NOINDEX__{{#babel:pt|en-3}}[[File:Redirect arrow without text.svg|45px|link=]][[m:User talk:Sir Lestaty de Lioncourt|Lestaty de Lioncourt (Meta-Wiki)]] 0738nao5e9r9j989zct5f35xw1x5bxc Gebruiker:Kwj2772/monobook.js 2 1928 6805 3462 2021-02-04T23:29:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6805 javascript text/javascript /*Global javascript*/ mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Kwj2772/remote.js&action=raw&ctype=text/javascript'); 6qoblfbclwx9c8zlf784b4brptfurt6 Gebruiker:Shanel/monobook.js 2 1930 6816 3444 2021-02-04T23:31:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6816 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Shanel/global.js&action=raw&ctype=text/javascript'); 14p5zkc7ozc0y8n5twgu541naa3a33d Gebruiker:WikimediaNotifier 2 1932 3447 2008-10-29T17:52:33Z WikimediaNotifier 248 Nuwe blad: <div style="text-align: center;"> ---- ---- '''[[m:User:WikimediaNotifier|WikimediaNotifier]]'''<!--...do not flag this account-->; operated by [[m:User:Melancholie|User:Melancholie]] ---... 3447 wikitext text/x-wiki <div style="text-align: center;"> ---- ---- '''[[m:User:WikimediaNotifier|WikimediaNotifier]]'''<!--...do not flag this account-->; operated by [[m:User:Melancholie|User:Melancholie]] ---- ---- </div> tor7u7wsypruve0zcafw99g58kaa6mm Gebruikerbespreking:WikimediaNotifier 3 1933 3448 2008-10-29T18:16:45Z WikimediaNotifier 248 Stuur aan na [[Gebruiker:WikimediaNotifier]] 3448 wikitext text/x-wiki #REDIRECT [[User:WikimediaNotifier]] e0ennyj78ghs157hdt808vmdmc9rd95 Gebruiker:WikimediaNotifier/frame.css 2 1934 3449 2008-10-29T20:35:14Z WikimediaNotifier 248 . 3449 css text/css <div style="background-color: #FEFEFE; border: 1px solid #ABABAB; padding: 0 1em;"> __NOEDITSECTION__ === {{{topic}}} === {{{content}}} :<small>&hellip; do '''not''' reply to this <u>automatically</u> delivered notification <span title="locally">here</span>; answer/discuss together '''[[meta:Talk:Global_notifications#{{{topic}}}|on Meta]]''', centrally!</small> </div> i5zq9jolr3qjxtjhnenvi6vdcoaog90 Gebruiker:Spacebirdy/monobook.js 2 1935 6819 3450 2021-02-04T23:31:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6819 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Spacebirdy/altækt.js&action=raw&ctype=text/javascript'); 7d2lp9lmd17ehx82s1xxx5lm94g4ah1 Gebruiker:Spacebirdy/monobook.css 2 1936 3451 2008-10-30T07:32:51Z Pathoschild 29 + global CSS ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3451 css text/css @import "http://meta.wikimedia.org/w/index.php?title=User:Spacebirdy/altækt.css&action=raw&ctype=text/css"; 7nvxzolr2g4w4mc8pm2n6reta20gvm4 Gebruiker:WikimediaNotifier/template 2 1937 3490 3489 2008-11-10T12:05:20Z WikimediaNotifier 248 3490 wikitext text/x-wiki <div style="background-color: #FEFEFE; border: 1px solid #ABABAB; padding: 0 1em;"> __NOEDITSECTION__ === {{{topic}}} === {{{content}}} <div style="float: right;"><small>&#91;[[{{#ifeq:{{User:WikimediaNotifier/translation}}|User:WikimediaNotifier/notifications|User:WikimediaNotifier/translation|{{User:WikimediaNotifier/translation}}}}#{{{topic}}}|local translation]]&#93;</small></div> :<small>&hellip; do '''not''' reply to this <u>automatically</u> delivered notification <span title="locally">here</span>; answer/discuss together '''[[meta:Talk:Global_notifications#{{{topic}}}|on Meta]]''', centrally!</small> </div> 554n4kii6e3whjuknwzbi3scfpljx57 Gebruiker:WikimediaNotifier/config.js 2 1938 3453 2008-10-30T12:23:51Z WikimediaNotifier 248 . 3453 javascript text/javascript <onlyinclude>{{{all|}}}{{{b|}}}{{{af|}}}{{{b:af|}}}</onlyinclude> 2bc4rhkthtsw653sv1399y78t15ch6x Gebruiker:WikimediaNotifier/self.js 2 1939 3455 3454 2008-10-30T13:41:07Z WikimediaNotifier 248 3455 javascript text/javascript {{<includeonly>subst:</includeonly>#if:{{{b:af|}}}|{{{b:af|}}}|{{<includeonly>subst:</includeonly>#if:{{{af|}}}|{{{af|}}}|{{<includeonly>subst:</includeonly>#if:{{{b|}}}|{{{b}}}|{{<includeonly>subst:</includeonly>#if:{{{else|}}}|{{{else}}}|}}}}}}}} gxw8ykz1w1cr4vwun4urla2lbuj4jzb Gebruiker:WikimediaNotifier/notifications 2 1940 7209 5594 2022-12-17T21:10:30Z Εὐθυμένης 2430 ([[c:GR|GR]]) [[File:Traducción.png]] → [[File:Icono de traducción.svg]] 7209 wikitext text/x-wiki <div dir="ltr" lang="en" xml:lang="en" style="direction: ltr; padding-top: 3px;"> {{#ifeq:{{{onlyTOC|}}}|| <!--/ / Mirrored/synchronized; do not change this page [use Meta]; translate on separate page! /--> <noinclude><div class="plainlinks" style="float: right; margin-top: -30px;">['''[[meta:Global_notifications/RSS|RSS]]&nbsp;[[File:Feed-icon.svg|12px|link=meta:Global_notifications/RSS]]''']</div></noinclude> <div style="clear: both; background-color: #FFFCFC;">{{User:WikimediaNotifier/translate}}</div> <div style="float: right; background-color: #EFEFEF; margin: 0 0 1em 1em; padding: 0 0 4px 3px; position: relative; z-index: 9;"> __TOC__ </div> {{User:WikimediaNotifier/template| topic = Wikimedia notification system |content = [[File:Mail-notification.svg|25px|link=m:Global notifications]] <small>''This is a '''global notification system''' for all Wikimedia wikis!''</small> <hr style="margin: 0;" /> <div style="background-color: #F7FFF7; border: 2px solid #F3F3F3; padding: 10px 20px 15px;"> If it is necessary to inform many/all wikis about something important, a [[meta:Global_notifications|global notification]] can be requested at '''[[meta:Global notifications/requests]]'''. It is possible to have wiki and/or language dependent text within every message. ''All Meta notifications are synchronized automatically, either on all wikis or just on specific, selected ones.'' To have a common access point, the messages are updated at '''[[{{NS:User}}:WikimediaNotifier/notifications]]''' ''(mirrored, any changes to this page will be overwritten; [[meta:Global_notifications/how-to#translation|use a separate page for translation]]);'' you can include this page<small>(s)</small> like a template wherever you want, let's say your village pump, with a description in your language! Have a look on the '''[[meta:Global notifications/how-to|Frequently Asked Questions]]''' to see how it can fit your needs! * <small>With '''[[meta:User:Pathoschild/Scripts/SynchCrosswiki|SynchCrosswiki]]''' there furthermore is an easy way to create or synchronize pages like user scripts on all wikis!</small> </div> <hr style="margin: 0;" /> ''&hellip; it's for spreading information; and for a better cross-wiki communication & collaboration!'' }}<br /> {{User:WikimediaNotifier/template| topic = Commons: Picture of the Year 2008 |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small class="GN-update_1">2009-04-19</small></span> <div style="float: left; margin-right: 15px;">[[File:POTY_barnstar_1_2008.svg|85px|link=m:commons:Project:Picture_of_the_Year/2008]]</div> The third annual '''[[m:commons:Project:Beeld van die jaar/2008|Picture of the Year Award]]''' on [[m:commons:Main_Page|Wikimedia Commons]] goes into its second (<u>final</u>) round! {{:User:WikimediaNotifier/updated| ''The final voting round is running from April 19th to ''April 30th'' (23:59 UTC).'' Have a look on the '''[[m:commons:Project:Picture of the Year/2008/Finalists|finalists]]''' and select your favourite featured picture of 2008.}} </div> }}<br /> {{User:WikimediaNotifier/template| topic = GNU Free Documentation License 1.3 |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small class="GN-update_5">2009-04-12</small></span> <div style="float: left; margin-right: 10px;">[[File:CC-devnations.svg|70px|link=http://creativecommons.org/licenses/by-sa/3.0]]</div> The [[meta:GNU Free Documentation License|GNU Free Documentation License]] has been released in [[w:en:GNU_Free_Documentation_License#Timeline|version 1.3]] by its responsible [[w:en:Free Software Foundation|Free Software Foundation]].<br />This is not least a result of a request by our [[wikimedia:Resolution:License_update|Board of Trustees]] in December 2007, trying to offer us a possibility to <u>also</u> license and share our wiki contents under the easier to use [[w:en:Creative_Commons_licenses#Original_licenses|Creative Commons CC-BY-SA]] (Attribution + ShareAlike) license. The [[meta:Wikimedia Foundation|Wikimedia Foundation]] will soon organize a community wide referendum to decide whether our '''GNU FDL''' licensed wikis should be made availabe under the terms of this free and common '''CC-BY-SA''' license too, see [[w:en:Dual-licensing|dual-licensing]]. <div style="float: right;">[[File:CC-logo.svg|75px|link=http://creativecommons.org/licenses/by-sa/3.0]]</div> See also a [[mailarchive:foundation-l/2008-November/046996.html|detailed summary]] for further reading.<sup class="plainlinks">([http://blog.wikimedia.org/2008/11/04/gnu-free-documentation-license-13-released/ source])</sup> On [[meta:Licensing update|Meta]] you can find [[meta:Licensing_update/Questions_and_Answers|further information (FAQ)]] and can [[meta:Licensing update|discuss]] the licensing update process of our wikis. {{:User:WikimediaNotifier/updated|'''A vote on [[meta:Licensing update|Meta]] is taking place from [[meta:Licensing update/Timeline|April 12, 2009]] to [[meta:Licensing update/Timeline|May 3, 2009]].'''}} </div> }}<br /> {{User:WikimediaNotifier/template| topic = Software news in brief |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small class="GN-update_3">2009-03-25</small></span> <table><tr><td style="padding-right: 15px;" valign="top">[[File:Namespace MediaWiki.1.svg|100px|link=Special:Version]]<div style="font-size: smaller; text-align: center;">[http://techblog.wikimedia.org/ Technical Blog]</div></td> <td style="font-size: smaller;"> {{:User:WikimediaNotifier/updated|1=<div style="margin: -3px 0 0;" /> * ''2009-03-25:'' <span class="plainlinks">The [[Special:Version|MediaWiki software]] with its [[Special:Version|extensions]] has been [http://www.mediawiki.org/w/index.php?title=Special:Code/MediaWiki/releasenotes&startrev=47458&endrev=48811&path=/trunk/phase3 updated] to SVN revision '''[http://www.mediawiki.org/w/index.php?title=Special:Code/MediaWiki/releasenotes&startrev=47458&endrev=48811&path=/trunk/phase3 48811]''' ([http://svn.wikimedia.org/viewvc/mediawiki/trunk/phase3/RELEASE-NOTES?r1=47457&r2=48811 release notes]).</span><!--[[:mw:This week's updates]]--> ** ''Major new features:'' New [[:mw:Help:Magic_words|magic word]] <code><nowiki>{{</nowiki>[[:mw:Help:Magic_words#Technical_metadata|REVISIONUSER]]<nowiki>}}</nowiki></code>, new special page [[Special:GlobalGroupPermissions]] for [[Special:GlobalUsers|global users]]; [[:rev:48801|etc]].}} * <span style="position: relative; margin-left: -20px; z-index: 9;">[[File:Stop bad orthography nuvola.svg|17px|link=w:en:Special:AbuseFilter]]</span> ''2009-03-17:'' The '''[[w:en:Special:AbuseFilter|AbuseFilter]]''' has also been activated for the English Wikipedia ''(Meta/dewiki: 2009-02-25)'' &ndash; the [[:mw:Extension:AbuseFilter|tool]] allows to automatically detect and/or prevent plain vandalism, spam and other pattern based changes. * ''2009-03-16:'' [[BugZilla:17714|TIFF support]] on Commons, [[BugZilla:15842|file/image renaming]] available for SysOps (through the [{{:MediaWiki:Move}}] tab). * ''2009-01-27:'' [[:mw:Extension:Collection|Collections]] will [[meta:Book tool/Schedule|soon]] be activated for all Wikimedia projects where they make sense, like currently for [http://blog.wikimedia.org/2009/01/27/wiki-to-print-feature-in-testing-in-the-german-wikipedia/ Wikibooks and the German Wikipedia] ''(2009-02-19: fr, pl, nl, pt, es, simple; en)'' &ndash; the extension lets your readers create PDF books to possibly order printed books. Use '''[http://pediapress.com/collection/ www.pediapress.com/collection]''' to create cross-wiki article collections of almost all wikis out there. * ''2009-01-26:'' Wikimedia will [http://blog.wikimedia.org/2009/01/26/mozilla-and-wikimedia-join-forces-to-support-open-video/ improve Ogg Theora/Vorbis support] with the help of the Mozilla Foundation. * ''2009-01-16:'' [[:mw:Extension:Drafts|Drafts]] are ready for [http://leuksman.com/log/2009/01/16/drafts-extension-enabled-on-test-wikipedia/ testing] &ndash; the extension makes backups of your unsaved edit sessions. * ''2008-12-17:'' Some major Wikipedias now have [[:en:Wikipedia:Searching#Wikipedia_search|enhanced]] search functionalities ([http://en.wikipedia.org/wiki/Special:Search/Esperanto?search=Esperant*&fulltext=1 example]), all other wikis have to wait for [[bugzilla:16685#c0|better hardware]]. * ''2008-12-03:'' Wikipedia will become [http://blog.wikimedia.org/2008/12/03/improved-usability-in-our-future/ more user-friendly for new volunteer writers] ([http://blog.wikimedia.org/2009/01/21/a-note-on-the-wikipedia-usability-initiative/ current info]); see '''[[meta:Wikipedia Usability Initiative|Wikipedia Usability Initiative]]'''! </td></tr></table> </div> }}<br /> {{User:WikimediaNotifier/template| topic = Wikimania 2009 |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2009-02-24</small></span> <div style="float: left; margin-right: 15px;">[[File:Wikimania.svg|50px|link=wm2009:Call_for_Participation]]</div> '''Wikimania 2009''', this year's global event devoted to [[foundation:|Wikimedia]] projects around the globe, is accepting submissions for presentations, workshops, [[wm2009:Call_for_Participation#Types_of_Submissions|panels]], posters, [[w:en:Open_Space_Technology|open space]] [[w:en:Open-space_meeting|discussions]], and even artistic works related to the Wikimedia projects or free content topics in general. The conference will be held from '''August 26''' to '''28''' in [[w:en:Buenos Aires|Buenos Aires]], [[w:en:Argentina|Argentina]]!<br />For more information, check the official '''[[wm2009:Call for Participation|Call for Participation]]'''. </div> }}<br /> {{User:WikimediaNotifier/template| topic = Quality illustrations |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2009-01-26</small></span> <div style="float: left; margin-right: 10px;">[[File:Great Wave off Kanagawa2.jpg|60px|link=m:Restoration.wikimedia.org]]</div> Beside an [[meta:Philip Greenspun illustration project|elder project]] for the creation and improvement of illustrations, there is a [[meta:Restoration.wikimedia.org|new project]] to grow our encyclopedic image [[meta:Restoration.wikimedia.org|restoration community]]. It's to provide media restorers with the technical resources they need, and to reach out to all the archives in the world. </div> }}<br /> {{User:WikimediaNotifier/template| topic = Software localization |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2009-01-01</small></span> <div style="float: left; margin-right: 5px;">[[Image:Icono de traducción.svg|70px|link=betawiki:Main_Page#What_is_Betawiki]]</div> ''The localization<!--user interface--> of {{SITENAME}}'s software <small>(MediaWiki)</small> and its extensions is an ongoing task, and you can help!'' ''There are '''[[betawiki:Special:LanguageStats/{{CONTENTLANGUAGE}}|statistics]]''' about how much of the [[:mw:Localisation_statistics|core messages]] and [[betawiki:Translating:Group_statistics#Group_statistics|system messages in total]] have been translated so far.'' ---- [[betawiki:Betawiki:Translator|Apply]], and '''help''' translating our software externally at [[betawiki:Main_Page#What_is_Betawiki|TranslateWiki.net]] <small>(='''Betawiki''', no Wikimedia project so far); have a look on the <span class="plainlinks">[http://translatewiki.net/wiki/Special:RecentChanges?namespace=8&trailer=/{{CONTENTLANGUAGE}} recent localization activity]</span> for <u>your language</u> [{{#language:{{CONTENTLANGUAGE}}}}].</small> </div> }}<br /> {{User:WikimediaNotifier/template| topic = Central Wikimedia help |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2008-12-24</small></span> [[Image:Wikimedia Community Logo.svg|16px|link=m:Goings-on]] There is a proposal to share [[meta:Wikimedia Help|Wikimedia's help pages]] by centralizing and localizing them on [[meta:Wikimedia Help|Meta]] or a dedicated wiki. </div> }}<br /> {{User:WikimediaNotifier/template| topic = FlaggedRevs review feature |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2008-11-28</small></span> <div style="float: left; margin-right: 15px;">[[Image:Artículo_bueno.svg|115px|link=m:FlaggedRevs]]</div> Beside the elder [[:mw:Help:Patrolled_edits|Patroller extension]] for patrolling recent changes and new pages, there is a highly configurable [[meta:MediaWiki|MediaWiki]] extension, called [[:mw:Extension:FlaggedRevs|FlaggedRevs]]. '''FlaggedRevs''' &ndash; being already enabled on [[meta:FlaggedRevs|several Wikimedia wikis]] &ndash; is a toolset for transparent and ensured article <u>patrolling</u> and/or for reliable <u>quality</u> assurance by specifying certain accurate article revisions that are shown to the public by default. Those stable article versions are identified in a release process by a trustable editorial staff and/or get approved by a reviewing expert staff. It is even possible to mark (tag) revisions of selected articles for different purposes, let's say for an article validation aiming on a print edition. Furthermore, there is the possibility to let your readers give you evaluative feedbacks. FlaggedRevs will make your wiki more reliable and thus more reputable over the time! Have a look on [[meta:FlaggedRevs|Meta's description]], the [[:mw:Extension:FlaggedRevs|technical description]] and the '''[[mailarchive:wikipedia-l/2008-June/030575.html|guidance for requesting FlaggedRevs]]'''! </div> }}<br /> {{User:WikimediaNotifier/template| topic = Interlanguage links |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2008-11-02</small></span> <div style="float: left; margin-right: 10px;"></div> Beside the ongoing discussion about introducing an [[meta:A_newer_look_at_the_interlanguage_link|interlanguage extension]] on Wikimedia projects to improve and centralize interwiki linking, an attempt to centralize the discussion about [[meta:Interwiki_synchronization|interlanguage link conflicts]] has been set up. </div> }}<br /> {{User:WikimediaNotifier/template| topic = Global bots |content = <div style="position: relative; margin-bottom: 6px;"> <span style="position: absolute; top: -38px; right: 42px; color: #BCBCBC;"><small>2008-11-01</small></span> <div style="float: left; margin-right: 10px;">[[Image:Bot Bienvenido.png|110px|link=m:Bot_policy/Implementation#Where_it_is_policy]]</div> On [[meta:Steward_requests/Bot_status#Global_bot_requests|Meta]], a bot account now can get a bot flag for all wikis that allow [[meta:Bot_policy#Global_bots|global bots]]!<br />To be able to run also on your {{SITENAME}}, the community has to <u>explicitly permit</u> global bots by local policy, '''[[meta:Bot_policy/Implementation#Where_it_is_policy|see list]]'''. ''To qualify for global bot access, the following requirements must be met by a bot:'' :::::# it must only maintain <u>interlanguage links</u> or fix <u>double-redirects</u> :::::# it must already be <u>active on several wikis</u>, with <u>long-term</u> contributions to back up its <u>trustworthiness</u><br /> </div> }} | #[[{{User:WikimediaNotifier/translation}}#Translation of the Week|Translation of the Week]] #[[{{User:WikimediaNotifier/translation}}#Commons: Picture of the Year 2008|Commons: Picture of the Year 2008]] #[[{{User:WikimediaNotifier/translation}}#GNU Free Documentation License 1.3|GNU Free Documentation License 1.3]] #[[{{User:WikimediaNotifier/translation}}#The Wiktionary logo dilemma|The Wiktionary logo dilemma]] #[[{{User:WikimediaNotifier/translation}}#Software news in brief|Software news in brief]] #[[{{User:WikimediaNotifier/translation}}#Wikimania 2009|Wikimania 2009]] #[[{{User:WikimediaNotifier/translation}}#Quality illustrations|Quality illustrations]] #[[{{User:WikimediaNotifier/translation}}#Software localization|Software localization]] #[[{{User:WikimediaNotifier/translation}}#Central Wikimedia help|Central Wikimedia help]] #[[{{User:WikimediaNotifier/translation}}#FlaggedRevs review feature|FlaggedRevs review feature]] #[[{{User:WikimediaNotifier/translation}}#Wikipedia globe logo|Wikipedia globe logo]] #[[{{User:WikimediaNotifier/translation}}#Interlanguage links|Interlanguage links]] #[[{{User:WikimediaNotifier/translation}}#Global bots|Global bots]] }} </div> iq0s4oyulv7hs7lhuoixw7y0qoon13q Gebruiker:SterkeBak 2 1941 3691 3459 2009-02-12T19:09:46Z CommonsDelinker 24 "Sterkebak.jpg" is verwyder omdat dit in Commons deur [[commons:User:Abigor|Abigor]] verwyder is omrede: User request 3691 wikitext text/x-wiki <div style="padding-right:40px; font-style:italic; text-align:right; font-size:225%; font-family:Georgia; margin-bottom:15px; color:#669;">I wanna find something I've wanted all along<br /><br /> Somewhere I belong</div> <center><div style="width:820px;"><div style="width:59%; display:block; float:left;"> {| style="border-spacing:8px; margin:0px -8px;" |class="MainPageBG" style="width:60%; border:1px solid #CEDFF2; background-color:#FFF; vertical-align:top; -moz-border-radius:10px;"| {| width="100%" cellpadding="2" cellspacing="5" style="vertical-align:top; background-color:#FFF; -moz-border-radius:10px;" ! style="background:#CFDEF1; font-family:Verdana, Arial, Helvetica, sans-serif; font-size:100%; border:1px solid #B1CDEB; text-align:left; padding-left:7px; -moz-border-radius:10px;"| <div style="float:right;">[[Image:Wbar_blue.jpg]]</div><div style="float:left;">[[Image:Wikipedia svg logo.svg|20px]]Userpage from SterkeBak</div> |- | style="font-family:Verdana, Arial, Helvetica, sans-serif; font-size:90%;"| <div class="plainlinks">Welcome to my userpage</div> Hello. I'm a Wikimedian who doesn't do a lot on this project. I am active at Commons. I am also an admin on Commons. If you want to talk to me use [[:Commons:User Talk:SterkeBak|my Commons talk page]]. (You can respond there in English, German and Dutch.) |} |} </div> <div style="width:40%; display:block; float:right;"> {| style="border-spacing:8px; margin:0px -8px;" |class="MainPageBG" style="width:60%; border:1px solid #CEDFF2; background:#FFF; vertical-align:top; -moz-border-radius:10px;"| {| width="100%" cellpadding="2" cellspacing="5" style="vertical-align:top; background-color:#FFF; -moz-border-radius:10px;" |- | [[Image:Cross of Sacrifice crop.jpg|250px|thumb|center|''Cross of Sacrifice'']] |} nv5csaubuzpaynssfo6ux7akxk27eb3 Gebruikerbespreking:Ahonc 3 1945 3467 2008-11-03T02:15:04Z Pathoschild 29 linked to global user talk page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3467 wikitext text/x-wiki '''''Please leave comments [[w:uk:User talk:Ahonc|here]] or [[commons:User talk:Ahonc|here]].''''' qxwpo8xry9wh2d609avpqlidy87mjfk Gebruiker:Dovi 2 1948 3472 2008-11-04T03:47:20Z Pathoschild 29 global user page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3472 wikitext text/x-wiki ==English== *'''[[m:s:User:Dovi|My user page at English Wikisource]] · [[m:s:User talk:Dovi|English Wikisource talk page]]''' *'''[[m:w:User:Dovi|My user page at English Wikipedia]] · [[m:w:User talk:Dovi|English Wikipedia talk page]]''' *'''But I'm most active at Hebrew Wikisource (see below).''' == Hebrew · עברית== *'''[[m:s:he:User:Dovi|Hebrew Wikisource user page]] · [[m:he:s:User talk:Dovi|Hebrew Wikisource talk page]]''' *'''[[m:s:he:User:Dovi|דף המשתמש שלי בעברית]] · [[m:s:he:User talk:Dovi|דף השיחה שלי בעברית]]''' cmx9nnxk989wmkxg5snkd6lqrbrfwmz Gebruiker:MF-Warburg/monobook.js 2 1949 6808 3476 2021-02-04T23:29:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6808 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:MF-Warburg/global.js&action=raw&ctype=text/javascript'); hcl9zzsf4l4u5t1wcdoyvou3hou6zhg Gebruiker:WikimediaNotifier/google 2 1950 3480 3478 2008-11-06T02:53:35Z WikimediaNotifier 248 3480 wikitext text/x-wiki [http://translate.google.com/translate?u=meta.wikimedia.org/wiki/Global_notifications&hl=nl&sl=en&tl=nl Google] hwz65htkb0ygwi83y933gjgyddzb8o4 Gebruiker:WikimediaNotifier/babelfish 2 1951 3482 3481 2008-11-06T03:22:43Z WikimediaNotifier 248 3482 wikitext text/x-wiki [http://babelfish.yahoo.com/translate_url?trurl=http://meta.wikimedia.org/wiki/Global_notifications&lp=en_nl Babel&nbsp;Fish] sn1vmspfahpb25zy22862cmj5smcjrl Gebruiker:WikimediaNotifier/translate 2 1952 3487 3484 2008-11-10T09:16:23Z WikimediaNotifier 248 3487 wikitext text/x-wiki <div style="margin-top: -19px; text-align: center;"><small><span title="Traduko">Machine translation</span>: {{User:WikimediaNotifier/google}} &ndash; {{User:WikimediaNotifier/babelfish}} &ndash; '''[[m:Global_notifications/machine_translation#{{CONTENTLANGUAGE}}|Service List]]''' &ndash; '''[[{{#ifeq:{{User:WikimediaNotifier/translation}}|User:WikimediaNotifier/notifications|User:WikimediaNotifier/translation|{{User:WikimediaNotifier/translation}}}}|Local Translation Page]]''' &#124; <span title="Esperanto">[http://traduku.net/cgi-bin/elitrad/elitrad?en_eo&u=meta.wikimedia.org/wiki/Global_notifications traduku]</span></small></div> 782xmtg5gq57sxcxl8h0emgcr3bfcsj Gebruiker:WikimediaNotifier/translation 2 1953 3486 2008-11-09T08:27:25Z WikimediaNotifier 248 . 3486 wikitext text/x-wiki User:WikimediaNotifier/notifications<noinclude> ;Here you can add the title of a translation page for [[User:WikimediaNotifier/notifications]] </noinclude> e65omq99a88pxmryxynlj0pc1kglypq Gebruiker:Waldyrious 2 1954 5642 4384 2019-07-01T10:33:34Z 1997kB 1873 1997kB het bladsy [[Gebruiker:Waldir]] na [[Gebruiker:Waldyrious]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Waldir|Waldir]]" to "[[Special:CentralAuth/Waldyrious|Waldyrious]]" 4384 wikitext text/x-wiki [[m:user:waldir|Waldir@meta.wikimedia]] 21phdoloxh3aqsmm2exmbqr3q3ipo83 Gebruiker:Cometstyles/monobook.js 2 1955 6790 3494 2021-02-04T23:26:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6790 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Cometstyles/global.js&action=raw&ctype=text/javascript'); eizeov0rcb6zuf4uw4lmvc7c4t36e60 Gebruiker:Melancholie/mmA 2 1956 3496 2008-11-12T11:54:25Z Melancholie 252 Preparation for [[Project:Most missed articles]]; see [[de:wikt:Wiktionary:Statistik/Suchanfragen]]/[[w:en:Wikipedia:Most missed articles]]! 3496 wikitext text/x-wiki '''{{{1}}}''' requests per day: [[{{{2}}}]] <sup>([[Spesiaal:Search/{{{2}}}|?]]/[[google:"{{{3|{{{2}}}}}}"|g]]{{{4|}}})</sup> o7a52tvcxwvwb12ao0h8g7ch15mg166 Gebruiker:Melancholie/mmA blacklist 2 1957 3498 2008-11-12T15:03:59Z Melancholie 252 Preparation for [[Project:Most missed articles]]; see [[de:wikt:Wiktionary:Statistik/Suchanfragen]]/[[w:en:Wikipedia:Most missed articles]]! 3498 wikitext text/x-wiki __NOINDEX__ <span style="color: #ba0000;">Requests</span> that shall not be shown at '''[[Wikibooks:Most missed articles]]''' ''(spam, nonsense, useless stuff)'' have to be listed [<code><nowiki><li></nowiki></code>] below: * Your title here * like this plahq4tptey0xgjo9tnig51cixep0og Gebruiker:Adriaan90 2 1958 3607 3520 2008-11-20T12:51:32Z Adriaan90 190 edit 3607 wikitext text/x-wiki Ek is meest aktief op die [[:w:|Afrikaanse Wikipedia]] onder [[:w:Gebruiker:Adriaan90|dieselfde naam]]. My voorstel vir 'n nuwe voorblad is [[Gebruiker:Adriaan90/Voorbladvoorstel|hier]] te vinde. n4evc40c73mx9e8t02lasj14anb156n Duits 0 1959 7213 7207 2023-01-04T20:39:38Z Kwamikagami 2379 7213 wikitext text/x-wiki [[Lêer:Legal status of German in the world.svg|thumb|upright=2|[[Duits/Inhoud|'''Keer na Inhoudsbladsy.''']]]] Hierdie Wikiboek het ten doel om die leser 'n begrip, matig of ten volle, van die Duitse taal te gee. {{wikipedia|Duits}} [[Kategorie:Boeke]] [[Kategorie:Tale]] [[pl:Niemiecki/Okładka]] 7g165svvt9qqp504gm9bv2t8t8iy1ed Sjabloon:Beeldinligting 10 1961 3524 2008-11-20T08:00:29Z Adriaan90 190 Sjabloon vanaf Wikipedia 3524 wikitext text/x-wiki {| cellpadding="3" class="toccolours" width="100%" ! style="background: #ccddff; text-align: right; vertical-align: middle;" width="15%" | Beskrywing: | style="background: #ffffff; text-align: left;"| {{{beskrywing|Onbekend}}} |- ! style="background: #ccddff; text-align: right; vertical-align: middle;" | Bron: | style="background: #ffffff; text-align: left;"| {{{bron|Onbekend}}} |- ! style="background: #CCddff; text-align: right; vertical-align: middle; white-space: nowrap" | Datum | style="background: #ffffff; text-align: left;"| {{{datum|Onbekend}}} |- ! style="background: #ccddff; text-align: right; vertical-align: middle;" | Beskikbaar gestel deur | style="background: #ffffff; text-align: left;"| {{{daarsteller|Onbekend}}} |- ! style="background: #ccddff; text-align: right; vertical-align: middle;" | Outeur | style="background: #ffffff; text-align: left;"| {{{outeur|Onbekend}}} |- {{#if: {{{ander_weergawes<includeonly>|</includeonly>}}} | ! style="background: #ccddff; text-align: right; vertical-align: middle;" {{!}} Ander weergawes van hierdie lêer {{!}} {{{ander_weergawes}}} }} |}<noinclude>{{sjablooninfo|1= ==Gebruik== <pre><nowiki> ==Beeldinligting== {{Beeldinligting | beskrywing = 'n beskrywing van die inhoud van die beeld | bron = bron van die beeld: óf 'n gepubliseerde boek óf 'n geldige URL, óf geskep deur gebruiker | datum = die datum waarop die oorspronklike beeld geskep is | daarsteller = persoon wat die beeld beskikbaar gestel het (indien dit verskil van die outeur) (b.v. NASA) | outeur = outeur van die beeld | ander_weergawes = ander weergawes van '''dieselfde''' beeld (indien die bestaan) }}</nowiki></pre>}}</noinclude><noinclude>[[Kategorie:Sjablone]]</noinclude> kkb0h3m6dt2vb6oke07o2k2lfjc0wdb Sjabloon:! 10 1962 5115 3525 2015-08-09T19:10:45Z YiFeiBot 1614 Verplasing van 2 interwikiskakels wat op [[d:|Wikidata]] beskikbaar is op [[d:q5400303]] 5115 wikitext text/x-wiki |<noinclude> ---- This is an auxiliary template allowing to encode "<code>|</code>" within template parameters. It is '''unnecessary''' to get a "<code>|</code>" in these cases, better use "<code>&amp;#124;</code>" for this purpose. However the "<code>|</code>" delimiter for a Wiki table has to be escaped by a template if it's used within a template, see also [[WP:QIF]]. Note that there's no such problem with "<code>!</code>" (exclamation mark), it only affects "<code>|</code>" (vertical bar) in conjunction with the [[m:Help:Parameter_default]] mechanism within tables. For obvious reasons this is a '''high risk template''', and it cannot be [[WP:SUBST|substituted]]. {{Lts|{{PAGENAME}}}} [[Category:Template templates|{{PAGENAME}}]] [[Category:Wikipedia special effects templates|{{PAGENAME}}]] </noinclude> 8w3k4ryxir5qqidkcz698zcu9bisvgv Sjabloon:Lts 10 1963 3527 2008-11-20T08:04:39Z Adriaan90 190 edit 3527 wikitext text/x-wiki <span class="plainlinksneverexpand">[[:Sjabloon:{{{1|{{PAGENAME}}}}}|Sjabloon:{{ucfirst:{{{1|{{PAGENAME}}}}}}}]]&#160;<tt>(</tt><small>[{{fullurl:Sjabloon:{{{1|{{PAGENAME}}}}}|action=edit}} edit]&#160;[[:Sjabloonbespreking:{{{1|{{PAGENAME}}}}}|talk]]&#160;[{{fullurl:Special:Whatlinkshere/Template:{{{1|{{PAGENAME}}}}}|limit=500}} links]&#160;[{{fullurl:Sjabloon:{{{1|{{PAGENAME}}}}}|action=history}} history]</small><tt>)</tt></span><noinclude> [[Kategorie:Interne skakel-sjablone|{{PAGENAME}}]]{{lts/Doc}} </noinclude> 8hivt4ntn5xhbh0kqr0rwzhg1mofwox Duits/Inhoud 0 1964 6670 6625 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Minorax|Minorax]] 6512 wikitext text/x-wiki * [[Duits/Duitsland]] * [[Duits/Die Duitse taal]] * [[Duits/Die alfabet]] * [[Duits/Uitspraak]] == Grammatik (Grammatika) == * [[Duits/Grammatika/Geslag]] * [[Duits/Grammatika/Persoonlike voornaamwoorde]] * [[Duits/Grammatika/Persoonlike voornaamwoorde (meervoud)]] * [[Duits/Grammatika/Werkwoorde]] * [[Duits/Grammatika/Werkwoorde (meervoud)]] * [[Duits/Grammatika/Naamval]] * [[Duits/Grammatika/Lidwoorde]] * [[Duits/Grammatika/Verkleinwoorde]] * [[Duits/Grammatika/Telwoorde]] * [[Duits/Grammatika/Tyd]] * [[Duits/Grammatika/Naamwoorde]] * [[Duits/Grammatika/Selfstandige naamwoorde (meervoud)]] == Bylae == * [[Duits/Bylae/Lys van onreëlmatige werkwoorde]] lqzjltsquq860muy6gs2gbuxwty9fvo Duits/Grammatika/Geslag 0 1965 6174 6173 2020-01-08T22:13:12Z ~riley 993 revert edits by [[Special:Contributions/178.247.154.188|178.247.154.188]] 6174 wikitext text/x-wiki In [[Afrikaans]] is daar net een vorm vir die bepaalde lidwoord wat vir elke selfstandige naamwoord gebruik word, nl. '''die'''. In Duits is daar egter drie verskillende vorme vir die bepaalde lidwoord, nl. '''die''', '''der''' en '''das'''. Hierdie drie woorde word gebruik om die geslag van die woord aan te dui: der (manlik), die (vroulik), das (onsydig, neutraal). In Duits word die geslag van 'n woord nie altyd deur sy betekenis bepaal nie. So kan lewelose voorwerpe manlik, vroulik of onsydig wees, bv. der Hut (hoed), die Schule (skool), das Glas (glas). {| style="margin: 1em 1em 1em 0; background: #f9f9f9; background: #f9f9f9; border: 1px #aaaaaa solid; border-collapse: collapse;" |- ! align="center" colspan="3" style="font-size:150%"| '''Woordeskat: Familie''' |- ! Enkelvoud ! Meervoud ! Afrikaans |- | der Vater | die Väter | vader |- | der Onkel | die Onkel | oom |- | der Bruder | die Brüder | broer |- | der Vetter | die Vettern | neef |- | der Großvater | die Großväter | oupa |- | der Schwager | die Schwäger | swaer |- | die Mutter | die Mütter | moeder |- | die Tante | die Tanten | tante |- | die Schwester | die Schwestern | suster |- | die Base | die Basen | nig |- | die Familie | die Familien | familie |- | die Großmutter | die Großmütter | ouma |- | die Schwägerin | die Schwägerinnen | skoonsuster |- | das Kind | die Kinder | kind |- | das Mädchen | die Mädchen | meisie |- | das Brüderchen | die Brüderchen | broertjie |- | das Schwesterchen | die Schwesterchen | sustertjie |} ==Taaloefeninge== # '''Gee die Duits vir:''' oom, suster, nig, meisie, broer, oupa, sustertjie, moeder, swaer, vader, broertjie, kind, familie # '''Lees die volgende selfstandige naamwoorde saam met hul lidwoorde:''' Base, Kind, Mädchen, Bruder, Großvater, Brüderchen, Vetter, Schwägerin, Onkel, Tante, Mutter, Schwester 1i4sv5mkrxq55m2ifnu3i0y5qkukoan MediaWikibespreking:Common.css 9 1966 4851 3543 2014-04-10T09:45:30Z MediaWiki message delivery 1367 /* External links icons removed */ nuwe afdeling 4851 wikitext text/x-wiki Hier gaan niks aan nie. Ek stel voor ons voer die css van die [[:w:MediaWiki:Common.css|Afrikaanse Wikipedia]] in. [[Gebruiker:Adriaan90|Adriaan90]] 09:25, 20 November 2008 (UTC) == External links icons removed == <div lang="en" dir="ltr" class="mw-content-ltr"> Hello! If this CSS adds or modifies icons shown after external links, you'll be interested in knowing that such icons have been [[gerrit:123817|removed from MediaWiki core]], a change which will reach this wiki in [[wikitech:Deployment|few days]]. You may want to consider whether you still need them. If you have questions, please ask at [[bugzilla:63725]]. Regards, [[m:User:Nemo_bis|Nemo]] 09:45, 10 April 2014 (UTC) </div> <!-- Message sent by User:Nemo bis@metawiki using the list at http://meta.wikimedia.org/w/index.php?title=Meta:Sandbox&oldid=8118966 --> 2pby0i9ehyl72jlk4qdpho6qxkhpckw Gebruiker:Adriaan90/Voorbladvoorstel 2 1967 3573 3569 2008-11-20T10:51:14Z Adriaan90 190 edit 3573 wikitext text/x-wiki <!--#### Boks "Inleiding" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}}" align="center">'''Welkom by Wikibooks'''</h2> <div style="border:1px solid #dfdfdf;padding:1em;padding-top:0.5em;"> {{:Tuisblad/Inleiding}} </div> <!--#### Boks "Boekrakke" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}}" align="center">Boekrakke</h2> <div style="margin-bottom:8px; {{:Tuisblad/Styl/Boks}}" align="center"> {{:Tuisblad/Onderwerpe}} |} </div> <!--#### Rechte Spalte #### Beachte: Rechte plus linke Spalte sollten zusammen 98% ergeben --> <div style="width: 54%; float: right;"> <!--#### Box "Empfehlenswerte Bücher" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} margin-top:0;">Aanbevole boeke</h2> <div style="{{:Tuisblad/Styl/Boks}}"> {{:Tuisblad/Aanbevole boeke}} </div> <!--#### Boks "Nuwe Boeke" #### <h2 style="{{:Tuisblad/Styl/Opskrif}}">Nuwe Boeke</h2> <div style="{{:Tuisblad/Styl/Boks}}"> {{:Tuisblad/Nuwe boeke}} </div>--> <!--#### Linke Spalte ####--> </div> <div style="width: 44%;"> <!--#### Box "Boek van die maand" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} margin-top:0;">Boek van die maand</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: .2em;"> {{:Tuisblad/Boek van die maand}} </div> </div> {{:Tuisblad/Innerlik}} <div style="clear: both; padding-bottom: 0.4em;" /> <!--#### Box "Susterprojekte" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} text-align: center;">Susterprojekte</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: 0.2em; padding-right: 0em; height: 10em;"> {{:Tuisblad/Susterprojekte}} </div> <!--#### Box "Impressum" ####--> <h2 style="{{:Tuisblad/Styl/Opskrif}} text-align: center;">Impressum, Lizenzbestimmungen usw.</h2> <div style="{{:Tuisblad/Styl/Boks}} padding-bottom: 0.5em; padding-right: 0em;"> <center><div style="text-align:center; padding-right:2em;"> [[Wikibooks:Impressum|Impressum]]&nbsp;| [[Wikibooks:Lizenzbestimmungen|Lizenzbestimmungen]]&nbsp;| [[Wikibooks:Über Wikibooks|Über Wikibooks]]&nbsp;| [[Wikibooks:Pressespiegel|Presse]] [http://wikimediafoundation.org/wiki/Hauptseite Wikimedia Foundation]&nbsp;| [http://www.wikimedia.de/ Wikimedia Deutschland e.V.]&nbsp;| [http://www.wikimedia.ch/ Wikimedia CH] </center> </div> </div>__NOTOC__ __NOEDITSECTION__ [[ar:]] [[cs:]] [[da:]] [[de:]] [[en:]] [[eo:]] [[es:]] [[fa:]] [[fi:]] [[fr:]] [[he:]] [[hr:]] [[hu:]] [[id:]] [[is:]] [[it:]] [[ja:]] [[ka:]] [[ko:]] [[mk:]] [[nl:]] [[no:]] [[pl:]] [[pt:]] [[ru:]] [[sq:]] [[sv:]] [[ta:]] [[tr:]] [[vi:]] [[zh:]] 27eo4jx6kk2mahc97v3iwpllheereai Tuisblad/Styl/Opskrif 0 1968 3549 3548 2008-11-20T09:39:50Z Adriaan90 190 toets 3549 wikitext text/x-wiki border:0;border-top:1px solid #dfdfdf;background-color:#E9F3FA;font-size:1.1em;font-weight:700;margin:8px 0 0;padding:0.2em 1em;-moz-border-radius:30px; -moz-border-radius-bottomleft:0; -moz-border-radius-bottomright:0; f3t0sbytoe6graha2cu2achl7e4avdc Tuisblad/Boekrakke 0 1969 7372 3559 2024-03-01T14:26:07Z Minorax 2092 ([[c:GR|GR]]) [[File:P culture.png]] → [[File:P culture.svg]] vva 7372 wikitext text/x-wiki {| width=100% style="font-family:sans-serif; background-color:#ffffff; " background="#ffffff" | {| | width=1%| [[Image:P physics.png|50px|Natur und Technik]] | width=46% style="border-bottom: 1px dashed #AAAAAA;" | '''Natuur en Tegnologie'''<br/> {{:Tuisblad/Boekrakke/Natuur en Tegnologie}} <!----------------------------------------------------------------> | width=1%| [[Image:P art.png|50px|Kunst und Kultur]] | width=46% style="border-bottom: 1px dashed #AAAAAA;" | '''Geesteswetenskappe, Kuns en Kultuur'''<br/> {{:Tuisblad/Boekrakke/Geesteswetenskappe, Kuns en Kultuur}} |} |- | {| | width=1%| [[Beeld:P countries.png|50px|Kontinente, Staaten, Organisationen]] | width=32% | '''Kontinente, Lande, Organisasies'''<br/> {{:Tuisblad/Boekrakke/Kontinente, Lande, Organisasies}} <!----------------------------------------------------------------> | width=1%| [[Beeld:Logo sociology.jpg|50px|Wikijunior]] | width=36% | '''[[Wikijunior]]'''<br/> {{:Tuisblad/Boekrakke/Wikijunior}} <!----------------------------------------------------------------> | width=1%|[[Image:P culture.svg|50px|Gesellschaft und Hobby]] | width=32% | '''Vermaak en Ontspanning'''<br/> {{:Tuisblad/Boekrakke/Vermaak en Ontspanning}} |} <!-- |- | style="text-align:center;border-top: 1px dashed #AAAAAA;"| <span style="font-size:1.2em;font-weight:bold">Weitere Regale</span><br/> '''[[Wikibooks:Bücherregale|Liste aller Bücherregale]] --> 3zwg86jfa3zvqv2mzvzarfdozg0dgb6 Tuisblad/Boekrakke/Geesteswetenskappe, Kuns en Kultuur 0 1970 3636 3562 2008-11-21T10:11:34Z Adriaan90 190 [[Kategorie:Tuisbladsjablone|{{PAGENAME}}]] 3636 wikitext text/x-wiki [[Boekrak:Bedryfskunde|Bedryfskunde]], [[Boekrak:Filosofie|Filosofie]], [[Boekrak:Geskiedenis|Geskiedenis]], [[Boekrak:Kuns|Kuns]], [[Boekrak:Letterkunde|Letterkunde]], [[Boekrak:Musiek|Musiek]] [[Boekrak:Opvoedkunde|Opvoedkunde]], [[Boekrak:Politiekwetenskap|Politiekwetenskap]], [[Boekrak:Regswetenskap|Regswetenskap]], [[Boekrak:Religie|Religie]], [[Boekrak:Rolprent|Rolprent]], [[Boekrak:Sielkunde|Sielkunde]], [[Boekrak:Sosiaalwetenskap|Sosiaalwetenskap]],<noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> 9kflu7ro4a4nh524wglzyyfu177xsk9 Tuisblad/Boekrakke/Natuur en Tegnologie 0 1971 3637 3558 2008-11-21T10:12:12Z Adriaan90 190 [[Kategorie:Tuisbladsjablone|{{PAGENAME}}]] 3637 wikitext text/x-wiki [[Boekrak:Aardrykskunde|Aardrykskunde]], [[Boekrak:Elektronika|Elektronika]], [[Boekrak:Inligtingstegnologie|Inligtingstegnologie]], [[Boekrak:Lewenswetenskap|Lewenswetenskap]], [[Boekrak:Logistiek|Logistiek]], [[Boekrak:Masjienkunde|Masjienkunde]], [[Boekrak:Medisyne|Medisyne]], [[Boekrak:Natuur|Natuur]], [[Boekrak:Natuurkunde|Natuurkunde]], [[Boekrak:Programmering|Programmering]], [[Boekrak:Rekenaartoepassingstegnologie|Rekenaartoepassingstegnologie]], [[Boekrak:Skeikunde|Skeikunde]], [[Boekrak:Sterrekunde|Sterrekunde]], [[Boekrak:Tegnologie|Tegnologie]], [[Boekrak:Wiskunde|Wiskunde]]<noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> 7mws7cd1sk83imjf2edu97lgxq0ozbp Tuisblad/Onderwerpe 0 1972 3560 2008-11-20T10:32:32Z Adriaan90 190 [[Tuisblad/Onderwerpe]] geskuif na [[Tuisblad/Boekrakke]]:&#32;Skuif 3560 wikitext text/x-wiki #REDIRECT [[Tuisblad/Boekrakke]] 0r79cuag8y3snri682321pomeq3qb8q Tuisblad/Boekrakke/Kontinente, Lande, Organisasies 0 1973 3633 3630 2008-11-21T10:10:15Z Adriaan90 190 [[Kategorie:Tuisbladsjablone|{{PAGENAME}}]] 3633 wikitext text/x-wiki [[Boekrak:Afrikaans as vreemde taal|Afrikaans as vreemde taal]], [[Boekrak:Tale|Tale]], [[Boekrak:Lander|Lander]] <noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> a1hpnszw4xniojymdc4dm1z0julgkhz Tuisblad/Boekrakke/Wikijunior 0 1974 3638 3563 2008-11-21T10:12:53Z Adriaan90 190 [[Kategorie:Tuisbladsjablone|{{PAGENAME}}]] 3638 wikitext text/x-wiki [[Wikijunior#Wêreld van ontdekking|Wêreld van ontdekking]], [[Wikijunior#Die natuurlike wêreld|Die natuurlike wêreld]], [[Wikijunior#Die wêreld van die Mensdom|Die wêreld van die Mensdom]]<noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> cdcklpaf8qakncntqeqvwlm61roa940 Tuisblad/Boekrakke/Vermaak en Ontspanning 0 1975 3634 3631 2008-11-21T10:10:32Z Adriaan90 190 [[Kategorie:Tuisbladsjablone|{{PAGENAME}}]] 3634 wikitext text/x-wiki [[Boekrak:Divers|Divers]], [[Boekrak:Reis|Reis]], [[Boekrak:Spyseniering|Spyseniering]], [[Boekrak:Sport|Sport]] <noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> rgqsr2x4a1s5pmfa7l9l76sbybmzxzj Tuisblad/Styl/Boks 0 1976 3567 2008-11-20T10:41:07Z Adriaan90 190 edit 3567 wikitext text/x-wiki border:1px solid #dfdfdf;padding:1em;padding-top:0.5em; 5lsyvhlv65yj49egcyql18bhmo7t7dn Tuisblad/Susterprojekte 0 1977 3572 3571 2008-11-20T10:50:24Z Adriaan90 190 edit 3572 wikitext text/x-wiki {| align="center" cellpadding="2" width="100%" |- | [[Beeld:Wikimedia Community Logo.svg|center|35px|<nowiki></nowiki>]] | [[m:Tuisblad|'''Meta-Wiki''']]<br />Projekkoördinasie | [[Beeld:Wikipedia-logo.png|center|35px|<nowiki></nowiki>]] | [[w:Tuisblad|'''Wikipedia''']]<br />Ensiklopedie | [[Beeld:Commons-logo.svg|center|35px|<nowiki></nowiki>]] | [[commons:Tuisblad|'''Wikimedia Commons''']]<br />Mediaversameling | [[Beeld:Wiktionary-logo-af.png|center|35px|<nowiki></nowiki>]] | [[wikt:Tuisblad|'''Wiktionary''']]<br />Woordeboek |- | [[Beeld:Wikisource-logo.svg|center|35px|<nowiki></nowiki>]] | [[s:Tuisblad|'''Wikisource''']]<br />Bronversameling | [[Beeld:Wikiquote-logo.svg|center|35px|<nowiki></nowiki>]] | [[q:Tuisblad|'''Wikiquote''']]<br />Aanhalings | [[Beeld:Wikinews-logo.svg|center|42px|<nowiki></nowiki>]] | [[n:Tuisblad|'''Wikinews''']]<br />Nuus | [[Beeld:Wikiversity-logo.svg|center|38px|<nowiki></nowiki>]] | [[v:|'''Wikiversity''']]<br />Leerinstelling |}<noinclude>[[Kategorie:Vorlage für Projektarbeit|{{PAGENAME}}]]</noinclude> frxdtz6gcb2m6ag49k8z5cg51fz8psr Tuisblad/Innerlik 0 1978 3574 2008-11-20T10:52:20Z Adriaan90 190 edit 3574 wikitext text/x-wiki <h2 style="{{:Tuisblad/Styl/Opskrif}} text-align: center;">In eie sake</h2> <div style="{{:Tuisblad/Styl/Boks}}"> Es sei darauf hingewiesen, dass ein Werkzeug wie Wikibooks, in welchem sehr viele Autoren in sehr vielen Büchern regelmäßig Änderungen durchführen, kein „endgültiges“ Wissen im Sinne einer endgültigen Wahrheit darstellen kann. Allerdings wird in unseren meisten Wiki-Büchern – auch in den nur halbfertigen – schon jetzt ein ''recht brauchbares Wissen'' vermittelt, da es bei uns bisher nur sehr selten Autoren gibt, die wirklich Unsinn schreiben. Da aber nicht alle Autoren das Fachgebiet studiert haben, und selbst Irrtümern unterliegen können, sollte man sich nicht ausschließlich auf Wikis in seiner Wissensvermittlung verlassen. Im Vergleich zu gedruckten Lehrbüchern haben Wikibooks aber auch viele Vorteile, etwa den der Aktualität: Neue Entwicklungen können sofort in unsere Wikibücher einfließen. Kleinere und größere Fehler können sofort korrigiert werden. Außerdem sind die hier dargestellten Kenntnisse schnell verfügbar und nicht zuletzt sind die Wikibooks für den Leser bis auf die reinen Online-Gebühren kostenlos… Was ist aber nun das oben erwähnte „gesicherte“ Wissen? Damit ist folgendes gemeint: „Theoriefindung“, im Sinne einer erstmaligen Erarbeitung neuen Wissens (dargestellt etwa durch Doktorarbeiten oder Forschungsberichte), soll nicht hier in Wikibooks stattfinden, sondern ist unserem Schwesterprojekt [[v:|Wikiversity]] vorbehalten. Wir konzentrieren uns auf Lehr- und allgemeine Fachbücher. </div> 71na2fzmzi8v6fby5vxdctqhyltotex Tuisblad/Inleiding 0 1979 3596 3595 2008-11-20T12:37:38Z Adriaan90 190 edit 3596 wikitext text/x-wiki Wikibooks is 'n gemeenskap van vrywilligers wat saamwerk om 'n vrye versameling boeke te skep. Daar is al duisende boeke in vele tale geskryf asook [[#Susterprojekte|ander projekte]] buiten die vrye biblioteek. Die Afrikaanse weergawe bevat nou {{NUMBEROFBOOKS}} boeke, waarvan {{NUMBEROFREADYBOOKS}} as voltooid geag word. Wat Wikibooks besonders maak is dat boeke gratis en vryelik beskikbaar is om te lees, te redigeer en te versprei. Die inhoud van Wikibooks (en dus ook u bydraes) val onder die [[:w:GNU/FDL-lisensie|GNU/FDL-lisensie]]. <noinclude>[[Kategorie:Sjablone vir projekbladsye|{{PAGENAME}}]]</noinclude> 48h84rnobhcq9ag5gvly1b920c0gt1v Sjabloon:NUMBEROFREADYBOOKS 10 1980 3593 3578 2008-11-20T12:25:48Z Adriaan90 190 edit 3593 wikitext text/x-wiki {{#expr: {{PAGESINCATEGORY:Voltooide boeke}} - 0 }}<noinclude> Voltooide boeke ---- Wenn hier Kategorien aufgelistet werden, muss die Null(0) durch die Anzahl der Kategorien ersetzt werden!! Die Zahl die hier steht, gibt die Zahl der fertigen Bücher an. Sie wird nicht durch die Software ermittelt. Es ist darum notwendig, hin und wieder zu kontrollieren, wie viele Bücher sich in [[:Kategorie:Voltooide boeke]] befinden. <!-- Bitte beachte, dass nicht auf jeder Seite gleich viele Bücher sind.--> Übertrage die Anzahl der fertigen Bücher in diese Vorlage. [[Kategorie:Vorlage für Projektarbeit|{{PAGENAME}}]] </noinclude> 4wjo7lhfmu2dwlued4r6f0wt1hblesi Sjabloon:NUMBEROFBOOKS 10 1981 3652 3651 2008-11-22T12:24:48Z Adriaan90 190 edit 3652 wikitext text/x-wiki {{#expr: {{PAGESINCATEGORY:Boeke}} - 4 }}<noinclude> Boeke ---- {{PAGESINCATEGORY:Boeke}} Seiten in der Kategorie:Boek (einschließlich Kategorien) ---- Diese Seite beziehungsweise ihrer Versionengeschichte dient der Statistik über die [[:Kategorie:Boeke|Liste aller Bücher]]. Ein von der Software ermittelt Wert ist über <nowiki>{{PAGESINCATEGORY:Boeke}}</nowiki> zugänglich. Davon werden die Kategorien(4) abgezogen. Die Vorlage muß also nur noch geändert werden, wenn sich die Anzahl der Kategorien ändert.-- [[Benutzer:InselAX|InselAX]] 10:57, 22. Jun. 2008 (CEST) [[Kategorie:Projeksjablone|{{PAGENAME}}]] </noinclude> mssfs75j5140a7mb5i8ffz44zvvaakr Tuisblad/Aanbevole boeke 0 1982 3623 3619 2008-11-21T06:15:27Z Adriaan90 190 toets 3623 wikitext text/x-wiki <!-- <div class="floatright" style="font-size:36px; text-align:center;"> <div style="border:solid black;border-width: thin">[[Bild:Blender3D Doku Banner1.png|100px]]</div></div> --> Die boek oor '''[[HTML]]''' is op 15 November 2005 geskryf en is een van die Afrikaanse Wikibooks se klein versameling boeke. Dit is dan ook een van die eerste boeke wat hier geskryf is. : Die HTML-boek gee 'n opsommende blik op die HTML-programmeringstaal. Dit verduidelik kortliks hoe dit toegepas word. <noinclude> [[Kategorie:Projeksjablone|{{PAGENAME}}]] </noinclude> n81h8qb18ksc39gy1kdn3694bviubyu Tuisblad/Boek van die maand 0 1983 3646 3645 2008-11-21T10:37:43Z Adriaan90 190 voeg sin by om voksie op voorblad groter te maaj 3646 wikitext text/x-wiki <!--[[Bild:Nuvola mimetypes source c.png|left]]--> Die boek '''[[Hoe om 'n atlas te gebruik]]''' is 'n kort handleiding wat die aard en nut van 'n atlas beskryf. Vir 'n persoon wat nog nooit 'n atlas gebruik het nie, sal die artikel help om te weet hoe om die geografiese indeks agter op die atlas te gebruik en hoe om die sleutel te vertolk. <div style="font-size:80%; text-align:right;">[[Hoe om 'n atlas te gebruik|... lees]] | [[Wikibooks:Boek van die maand#Vorige boeke van die maand|vorige boeke van die maand]] </div><noinclude>[[Kategorie:Tuisbladsjablone|{{PAGENAME}}]]</noinclude> qzdikmu5xmdxwocd8nitsm7jp4tbcwu Duits/Bylae/Lys van onreëlmatige werkwoorde 0 1984 6476 6447 2020-02-12T18:20:41Z Meiræ 1408 rv 6476 wikitext text/x-wiki Onreëlmatige werkwoorde word gedefinieer as daardie werkwoorde waar die klinker in die stam kan verander, afhangende van wie die werk verrig, of in watter tyd die werk verrig word. Hier volg 'n lys van algemene onreëlmatige werkwoorde. Vir skeibare werkwoorde word slegs nie stamvorm gegee: vir ''aufschreiben'', sien ''schreiben'', vir ''anrufen'', sien ''rufen'', ens. {| style="width:80%; margin: 1em 1em 1em 0; background: #f9f9f9; background: #f9f9f9; border: 1px #aaaaaa solid; <!--border-collapse: collapse;-->" |- ! align="center" colspan="4" style="border-bottom: 1px solid #aaaaaa; font-size:150%"| '''Lys van onreëlmatige werkwoorde'''<br />'''Liste der unregelmäßigen Verben''' |- ! colspan="1" | ! colspan="3" style="border-bottom: 1px solid #aaaaaa; border-left: 1px solid #aaaaaa" | er/sie/es |- ! syle="width: 25% style="border-bottom: 1px solid #aaaaaa" | Infinitief<br />Infinitiv ! syle="width: 25% style="border-bottom: 1px solid #aaaaaa; border-left: 1px solid #aaaaaa" | Teenwoordige tyd<br />Präsens ! syle="width: 25% style="border-bottom: 1px solid #aaaaaa" | Onvoltooide verledetyd<br />Präteritum ! syle="width: 25% style="border-bottom: 1px solid #aaaaaa" | Voltooide verledetyd<br />das Perfekt |- | befehlen | befiehlt | befahl | hat befohlen |- | bekommen | bekommt | bekam | hat bekommen |- | beschreiben | beschreibt | beschrieb | hat beschrieben |- | bitten | bittet | bat | hat gebeten |- | bleiben | bleibt | blieb | ist geblieben |- | braten | bräten | briet | hat gebraten |- | bringen | bringt | brachte | hat gebracht |- | denken | denkt | dachte | hat gedacht |- | erschließen | erschließt | erschloss | hat erschlossen |- | fahren | fährt | fuhr | ist gefahren |- | fallen | fällt | fiel | ist gefallen |- | fangen | fängt | fing | hat gefangen |- | finden | findet | fand | hat gefunden |- | geben | gibt | gab | hat gegeben |- | gehen | geht | ging | ist gegangen |- | gewinnen | gewinnt | gewann | hat gewonnen |- | halten | hält | hielt | hat gehalten |- | helfen | hilft | half | hat geholfen |- | kommen | kommt | kam | ist gekommen |- | lassen | lässt | ließ | hat gelassen |- | laufen | läuft | lief | ist gelaufen |- | leihen | leiht | lieh | hat geliehen |- | lesen | liest | las | hat gelesen |- | liegen | liegt | lag | hat gelegen |- | nehmen | nimmt | nahm | hat genommen |- | nennen | nennt | nannte | hat genannt |- | pfeifen | pfeift | pfiff | hat gepfiffen |- | rennen | rennt | rannte | ist gerannt |- | schließen | schließt | schloss | hat geschlossen |- | schlafen | schläft | schlief | hat geschlafen |- | schlagen | schlägt | schlug | hat geschlagen |- | schneiden | schneidet | schnitt | hat geschnitten |- | schreiben | schreibt | schrieb | hat geschrieben |- | schreien | schreit | schrie | hat geschrien |- | sehen | sieht | sah | hat gesehen |- | sitzen | sitzt | saß | hat gesessen |- | sprechen | spricht | sprach | hat gesprochen |- | springen | springt | sprang | ist gesprungen |- | stehen | steht | stand | ist/hat gestanden |- | stehlen | stiehlt | stahl | hat gestohlen |- | steigen | steigt | stieg | ist gestiegen |- | streiten | streitet | stritt | hat gestritten |- | tragen | trägt | trug | hat getragen |- | treiben | treibt | trieb | hat getrieben |- | tun | tut | tat | hat getan |- | verbinden | verbindet | verband | hat verbunden |- | vergehen | vergeht | verging | ist vergangen |- | vergleichen | vergleicht | verglich | hat verglichen |- | verlassen | verlässt | verließ | hat verlassen |- | verlieren | verliert | verlor | hat verloren |- | werden | wird | wurde | ist geworden |- | zereißen | zerreißt | zeriss | hat zerissen |- | ziehen | zieht | zog | ist/hat gezogen |} dhkg642gyd50cik56w65fgxgkmmysz8 Kategorie:Boeke 14 1985 3597 2008-11-20T12:39:34Z Adriaan90 190 beskrywing 3597 wikitext text/x-wiki Alle boeke word in hierdie kategorie saamgevat. 03edhlp9voy3rm0z83p3oje7fda17f2 Sjabloon:Skrap 10 1987 3601 3600 2008-11-20T12:45:37Z Adriaan90 190 edit 3601 wikitext text/x-wiki {| name="Deletion notice" cellspacing="8" cellpadding="0" style="width:100%; clear:both; margin:0.5em auto; background-color:#fee; border:2px solid #CC0000;" | [[Beeld:Nuvola apps error.svg|100px]] | <big>'''Hierdie bladsy is 'n [[Wikibooks:Spoedige verwyderings|kandidaat vir spoedige verwydering]] om die volgende rede:'''</big><p>'''{{{1}}}'''</p> As u nie die spoedige verwydering van hierdie bladsy steun nie, kan u u besware op die [[Bespreking:{{PAGENAME}}|besprekingsblad]] opper. Sien gerus [[Wikibooks:Spoedige verwyderings]] vir redes waarom bladsye soos hierdie vir spoedige verwydering gemerk word. Onthou om [[Special:Whatlinkshere/{{NAMESPACE}}:{{PAGENAME}}|bladsye wat na hierdie bladsy verwys]] en <span class=plainlinks>[{{SERVER}}{{localurl:{{NAMESPACE}}:{{PAGENAME}}|action=history}} hierdie bladsy se geskiedenis]</span> na te gaan vóór verwydering. '''Moenie hierdie kennisgewing verwyder nie.''' |}<includeonly>__NOEDITSECTION__[[Kategorie:Kandidate vir spoedige verwydering]]</includeonly><noinclude>[[Kategorie:Artikelstatussjablone]]{{sjablooninfo|1=Plaas '''<nowiki>{{skrap|</nowiki>''rede''<nowiki>}}</nowiki>''' of '''<nowiki>{{delete|</nowiki>''rede''<nowiki>}}</nowiki>''' om die kennisgewing op die bladsy aan te bring. Vir bladsye wat hierdie kennisgewing bevat, sien [[:Kategorie:Kandidate vir spoedige verwydering]].}}</noinclude> 1wb8lxwze1rywh243ax7fuy7phwgrks Sjabloon:Saadjie 10 1988 3602 2008-11-20T12:48:34Z Adriaan90 190 edit 3602 wikitext text/x-wiki <div class="notice metadata plainlinks" id="stub">[[Beeld:Wiki letter w.svg|45px]] ''Hierdie boek is 'n [[Wikibooks:Saadjie|saadjie]]. Voel vry om Wikibooks te help deur dit [{{fullurl:{{FULLPAGENAME}}|action=edit}} uit te brei].''</div><includeonly>[[Kategorie:{{#if:{{{1|}}}|{{{1}}}saadjies|Saadjies}}]]</includeonly><noinclude>{{sjablooninfo|1=Sit '''{{[[sjabloon:saadjie|saadjie]]}}''' onderaan bladsye om gebruikers in te lig dat die boek baie dun is en dat hulle kan help om die boek uit te brei.}}[[Kategorie:Artikelstatussjablone]] </noinclude> sb9y231pkor4ilfj2i085piqep7t93x Html 0 1989 3606 2008-11-20T12:50:41Z Adriaan90 190 [[Html]] geskuif na [[HTML]]:&#32;Korrekte titel 3606 wikitext text/x-wiki #REDIRECT [[HTML]] nlqbt92k4slz3z9aregw49317fens27 Kategorie:Rekenaartoepassingstegnologie 14 1990 3609 2008-11-20T12:52:33Z Adriaan90 190 [[Kategorie:Tegnologie]] 3609 wikitext text/x-wiki [[Kategorie:Tegnologie]] 1omu60q0s0ahsd7lu2fwouzqlrlda4w Kategorie:Tegnologie 14 1991 3610 2008-11-20T12:53:09Z Adriaan90 190 [[Kategorie:Vakgebiede]] 3610 wikitext text/x-wiki [[Kategorie:Vakgebiede]] caoznx0iejs0ncy1l8ugbwgq1fny4o4 Kategorie:Vakgebiede 14 1992 3611 2008-11-20T12:53:27Z Adriaan90 190 [[Kategorie:Alles]] 3611 wikitext text/x-wiki [[Kategorie:Alles]] 27cseortm8jsl20kstgzin2lqx0geue Kategorie:Alles 14 1993 3643 3612 2008-11-21T10:16:40Z Adriaan90 190 edit 3643 wikitext text/x-wiki Hierdie is die hoofkategorie. Alle kategorieë word in hierdie kategorieboom saamgevat. gz0v3pmwn8oyu77saz9xxn44faovi96 Duits/Duitsland 0 1994 7191 6656 2022-07-11T00:40:22Z Kwamikagami 2379 7191 wikitext text/x-wiki [[Beeld:Legal status of German in Europe.svg|right|frameless]] Van al die lande in Wes-Europa is Duitsland, met 'n oppervlakte van ongeveer die helfte van Suid-Afrika, seker die mees sentraal geleë. Hierdie sentrale ligging speel 'n baie groot rol. Op handelsgebied is dit besonder gunstig, want Duitsland grens aan die belangrikste Europese lande soos Nederland, België, Frankryk, Italië en die Balkanlande, en is naby die Britse Eilande. dus49iyqibuk1oiss1m8aoj5zax75oy Kategorie:Aardrykskunde 14 1995 3616 2008-11-20T13:09:47Z Adriaan90 190 [[Kategorie:Vakgebiede]] 3616 wikitext text/x-wiki [[Kategorie:Vakgebiede]] caoznx0iejs0ncy1l8ugbwgq1fny4o4 Duits/Die Duitse taal 0 1996 6774 6769 2020-10-22T19:33:44Z Praxidicae 1951 rvv 6766 wikitext text/x-wiki Die woord "deutsch" beteken inheems of nasionaal en is van die woord "diet", wat volk beteken, afgelei. Dit is sedert die middel van die 8ste eeu gebruik vir die gemeenskaplike taal van die Duitse stamme. Van die taal is die naam ook op die volk oorgedra. Al die Germane het oorspronklik dieselfde taal gepraat nl. Oer-Germaans. Met verloop van tyd het daaruit verskillende Germaanse tale ontstaan nl. Oos-Germaans, Noord-Germaans en Wes-Germaans. Wes-Germaans het weer in verskeie dialekte verdeel, en Duits het uit een van hulle ontwikkel. Stamboom van die Germaanse taalgroep: *Oer-Germaans **Oos-Germaans ***Goties **Noord-Germaans ***Deens ****Groenlands ***Noors ***Sweeds ***Yslands **Wes-Germaans ***Duits ***Engels ***Nederlands ***Vlaams ***Afrikaans In Duitsland word verskeie dialekte (Mundarten) gevind. Dit is 'n afwyking van die algemene taal wat net mondelings gebruik word en in 'n bepaalde deel of streek voorkom. So groot is die verskille soms tussen die dialekte dat iemand wat die een praat nie veel van die ander verstaan nie. Deur sy Duitse Bybel het Luther aan die Duitsers 'n algemene taal wat vir die hele Duitsland gegeld het, gegee. Die algemene spreektaal (Umgansprache) is die taal van die daaglikse lewe, wat saam met die skryftaal (Hochdeutsch) ontwikkel het, maar net mondelings gebruik word. Dit wyk ook soms van die skryfttaal af en word deur die dialekte beïnvloed. [[en:German/Appendices/History]] 1unaoa5kumxwkls7aqx56406kaghll6 Sjabloon:Anker 10 1998 3640 3626 2008-11-21T10:15:26Z Adriaan90 190 [[Kategorie:Navigasiesjablone]] 3640 wikitext text/x-wiki <includeonly><span id="Anker:{{{1}}}">{{#if:{{{2|1}}}||{{{1}}}}}</span></includeonly><noinclude> Vorlage übernommen von [[w:Benutzer:StefanL]]. -- [[Benutzer:Klaus Eifert|Klaus Eifert]] 21:15, 27. Dez 2005 (UTC) <tt><nowiki>{{Anker|Sprungmarke}}</nowiki></tt> erzeugt eine Sprungmarke, auf die mit <tt><nowiki>[[#Anker:Sprungmarke|hier geht es zur Sprungmarke]]</nowiki></tt> oder mit <tt><nowiki>[[Seite#Anker:Sprungmarke|hier geht es zur Sprungmarke auf einer anderen Seite]]</nowiki></tt> zurückverwiesen werden kann. Der Titel der Sprungmarke selbst wird im Browser nicht dargestellt, es sei denn, es folgt noch ein senkrechter Strich: <tt><nowiki>In diesem Text kommt eine {{Anker|Sprungmarke|}} vor. Klicke [[#Anker:Sprungmarke|hier,]] um sie anzuzeigen.</nowiki></tt> Mit dieser Vorlage kann man auf eine beliebige Stelle im Text verweisen, nicht nur auf die Überschriften. Ein Verweis auf eine Überschrift funktioniert nicht mehr, wenn jemand die Überschrift verändert. Es passiert häufig, dass jemand '''(erledigt)''' an eine Überschrift anhängt oder eine Überschrift anderweitig verändert. Vorläufige Beschreibung an einem Beispiel: In [[Hilfe:Seite verschieben/ Redirect löschen]] habe ich vor der Überschrift <nowiki>== Stellen des Löschantrags ==</nowiki> den Baustein '''<nowiki>{{Anker|sla}}</nowiki>''' eingefügt. Im übergeordneten Artikel [[Hilfe:Seite verschieben]] sowie [[Hilfe:Seite verschieben/ Redirect löschen#Anker:sla|hier]] habe ich den folgenden Text eingefügt: '''<nowiki>Lies hier, wie man einen [[Hilfe:Seite verschieben/ Redirect löschen#Anker:sla| Redirect korrekt löscht]].</nowiki>''' Den Effekt sieht man gut, wenn man die Höhe des Browserfensters verkleinert. Obwohl die Überschrift inzwischen in <nowiki>== Stellen des Löschantrags für den Redirect ==</nowiki> verändert worden ist, funktioniert der Sprung zum Anker. Siehe dazu auch im Wikibooks-Lehrbuch, [[Hilfe:Seiten verlinken|wie man Seiten verlinkt]]. [[Kategorie:Navigasiesjablone|{{PAGENAME}}]] </noinclude> etdvv8c6oone9b8oiiuxziha3rhqb9g Gebruiker:Lar 2 1999 3627 2008-11-21T06:38:27Z Pathoschild 29 global user page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3627 wikitext text/x-wiki {| |- |valign="top"| Hi. I am Larry Pieniazek, user Lar on the English Wikipedia. See my page ([[m:en:user:Lar|user:Lar]]) there for more information about me and see [[m:User:Lar/WikiMatrix|my WikiMatrix]] on meta for info about my other accounts. For best results, leave messages on my talk page ([[m:en:user talk:Lar|user talk:Lar]]) on the English Wikipedia, or on my talk page at Meta ([[m:user talk:Lar|user talk:Lar]]), as I may not see them here. Thanks! <div style="border:1px solid #000; margin:0 1em 0 1em; padding:10px; clear:both; background:#FF9;"> I am a [[m:Stewards|steward]] ([{{fullurl:m:Stewards/elections 2007/statements/Lar}} my request], [{{fullurl:m:Special:Listusers|limit=1&username=Lar}} verify], [{{fullurl:m:Special:Log|type=rights&page=User:lar}} rights log]) here and at all WMF projects. If I can be of any assistance please do not hesitate to ask. Please remember that, [[m:Steward policies|per policy]], stewards do not take sides in disputes, do not decide matters for themselves (instead they seek to understand community consensus), and do not act when local processes exist and provide for a mechanism for the action. Please use the defined pages (such as [[m:Steward requests/Permissions]], [[m:Steward requests/Bot status]], or [[m:Steward requests/Checkuser]]) rather than direct requests, wherever possible. Note: while I do carry out cross wiki checkuser requests regularly, per steward policy and practice I will not act as a steward on my home wikis (en:wp, en:ws, commons, meta) at all, except in exceedingly rare, emergency circumstances. If the matter involves a need for discretion please feel free to email me using my email link, and note that you consider the matter private. </div> | {| style="width:242px; border:1px solid #99B3FF;" | align="center" | '''[[m:en:Wikipedia:Babel|Babel]]''' |- | {{user af-0}} |- | {{user en}} |- | {{user de-1}} |} |} dw5vrez4adq6qi8fdcxwkqcrgppxws7 Kategorie:Projeksjablone 14 2001 3632 2008-11-21T10:09:41Z Adriaan90 190 [[Kategorie:Sjablone]] 3632 wikitext text/x-wiki [[Kategorie:Sjablone]] hg29yeqggq493yu0hsxo57z61ssm9e2 Kategorie:Tuisbladsjablone 14 2002 3635 2008-11-21T10:10:55Z Adriaan90 190 [[kategorie:projeksjablone]] 3635 wikitext text/x-wiki [[Kategorie:Projeksjablone]] 7iklxoyeaja9fqnb25tw7aherb4bl42 Kategorie:Navigasiesjablone 14 2003 3641 2008-11-21T10:15:41Z Adriaan90 190 [[Kategorie:Sjablone]] 3641 wikitext text/x-wiki [[Kategorie:Sjablone]] hg29yeqggq493yu0hsxo57z61ssm9e2 Gebruikerbespreking:Adriaan90 3 2005 4704 3816 2013-09-02T10:54:17Z MarcGarver 1161 4704 wikitext text/x-wiki Ek het vir jou admin regte gegee. Ek het so hier en daar 'n paar idees vir wikiboeke maar ek twyfel of ek in die afsienbare toekoms self veel gaan bydrae. Dankie vir jou puik bydraes. --[[Gebruiker:Renier Maritz|Renier Maritz]] 06:13, 23 November 2008 (UTC) :Dankie RAM. Ek het hier 'n stapel outydse boeke oor 'n paar tale wat ek graag wil gebruik om wikiboeke mee saam te stel. [[Gebruiker:Adriaan90|Adriaan90]] 06:25, 23 November 2008 (UTC) == Code update == Hello Adriaan90,<br />please see [[MediaWiki_talk:Common.js#Code_update_of_de:MediaWiki:If-search.js]]. --- Best regards, [[Gebruiker:Melancholie|Melancholie]] 06:25, 26 Maart 2009 (UTC) == nieuwe voorblad == Zou je zo vriendelijk willen zijn om een nieuw voorblad te ontwerpen zonder duits of links naar niet bestaande afrikaanse projecten. [[Gebruiker:Carsrac|Carsrac]] 17:11, 23 Oktober 2009 (UTC) : Die huidige ontwerp is nie voltooid nie; ek sou dit graag wou voltooi in my vrye tyd of dalk 'n meer ooglike uitleg invoer. Ek is eintlik ten gunste daarvan om skakels na nie-bestaande projekte te behou omdat hierdie skakels bewustheid skep dat die projekte nog nie bestaan nie en dat dit dan moontlik mense sal aanspoor om te help met die stigting van hierdie projekte. In ieder geval, ek dink nie dit doen leed om hierdie skakels te behou nie, maar as ander dit so sou wil dan kan ons dit natuurlik verwyder.[[Gebruiker:Adriaan90|Adriaan90]] 10:29, 4 November 2009 (UTC) ==Your admin status== Hello. I'm a [[:m:stewards|steward]]. A new [[:m:Admin activity review|policy]] regarding the removal of "advanced rights" (administrator, bureaucrat, etc.) was adopted by [[:m:Requests for comment/Activity levels of advanced administrative rights holders|community consensus]] recently. According to this policy, the stewards are reviewing of administrators' and bureaucrats' activity on wikis with no inactivity policy. You meet the inactivity criteria (no edits and no log actions for 2 years) on af.wikibooks, where you are an administrator and a bureaucrat. Since af.wikibooks does not have an own administrators' rights review process, the global one applies. If you wish to retain your rights, you should notify the community that the stewards sent you this information about your inactivity to discuss the matter. Following your community's discussion, if the community then wants that you keep your rights, please contact the stewards at [[:m:Stewards' noticeboard]], and link to the discussion of the local community, where they express their wish to continue to maintain the rights, and demonstrate a continued requirement to maintain these rights. We stewards will evaluate the responses. If there is no response at all after approximately one month, we will proceed to remove your administrative rights. In cases of doubt, we will evaluate the responses and will refer a decision back to the local community for their comment and review. If you have any questions, please contact us on [[:m:Stewards' noticeboard]]. Best regards, [[Gebruiker:QuiteUnusual|QuiteUnusual]] ([[Gebruikerbespreking:QuiteUnusual|kontak]]) 10:42, 2 September 2013 (UTC) 0kvq784p252f0mx10fbl4bx201u9yyk MediaWiki:Common.css 8 2006 5251 5227 2017-06-04T20:43:20Z Nemo bis 413 Replace deleted image with Commons equivalent [[File:Monobook-bullet.png]]. [[phabricator:T166979]]. 5251 css text/css /* Gemeenskaplike CSS vir alle omslae. */ /* Notice to Administrators! Any changes to Monobook.css or Common.css should be first proposed to [[Wikipedia:Geselshoekie]]. Thank you. */ /*<pre><nowiki>*/ /* Tabelstyl vir die omslag van normale tabelle. Ook bekend as "wikitable" of "prettytable". */ table.wikitable, table.prettytable, table.tabel, table.mooitabel { margin: 1em 1em 1em 0; background: #f9f9f9; border: 1px #aaaaaa solid; border-collapse: collapse; } table.wikitable th, table.wikitable td, table.prettytable th, table.prettytable td, table.mooitabel th, table.mooitabel td, table.tabel th, table.tabel td { border: 1px #aaaaaa solid; padding: 0.2em; } table.wikitable th, table.prettytable th, table.mooitabel th, table.tabel th { background: #f2f2f2; text-align: center; } table.wikitable caption, table.prettytable caption, table.mooitabel caption, table.tabel caption { margin-left: inherit; margin-right: inherit; } /* Style vir "kennisgewings" */ .notice, .kennisgewing { text-align: justify; margin: 1em; padding: 0.2em; } #disambig, #dubbelsinnig { border-top: 3px double #cccccc; border-bottom: 3px double #cccccc; } #spoiler { border-top: 2px solid #ddd; border-bottom:2px solid #ddd; } /* Standaardbesprekingbladstyl */ .Talk-Notice, .Bespreking-Kennisgewing { border: 1px solid #C0C090; background-color: #F8EABA; margin-bottom: 3px; width: 80%; border-spacing: 3px; margin-left: auto; margin-right: auto; } .Talk-Notice:after, { content: "Die CSS vir hierdie sjabloon moet verander word. Sien [[Wikibooks:Sjabloonstandaardisering]]. "; } /* Maak dat sjabloonagtergrond in alle webblaaiers korrek vertoon. */ .Talk-Notice td, .Bespreking-Kennisgewing td { background: inherit; } /* Metadata */ table.metadata, tabel.metadata { border: 1px solid #aaaaaa; display: none; speak: none; } .metadata-label, .metadata-etiket { color: #aaaaaa; } /* Maak dat aansture in skuinsdruk vertoon op [[Spesiaal:Allpages]]. */ .allpagesredirect { font-style: italic; } /* Choose whether to have AD/BC dates or CE/BCE dates*/ /* First, the default : display both : See templates ADCE and BCEBC for how these are used*/ .Use_Default_Date_Convention { display: inline; } .Use_AD_and_BC { display: none; } .Use_BCE_and_CE { display: none; } /* If you want to display AD and BC add the following to User:You/monobook.css page */ /* .Use_Default_Date_Convention { display: none; } .Use_AD_and_BC { display:inline; } .Use_BCE_and_CE { display:none; } */ /*If you want to display CE and BCE add the following to User:You/monobook.css page */ /* .Use_Default_Date_Convention { display: none; } .Use_AD_and_BC { display:none; } .Use_BCE_and_CE {display:inline; } */ /* Standard Navigationsleisten, aka box hiding thingy from .de. */ div.Boxmerge, div.NavFrame { margin: 0px; padding: 4px; border: 1px solid #aaa; text-align: center; border-collapse: collapse; font-size: 95%; } div.Boxmerge div.NavFrame { border-style: none; border-style: hidden; } div.NavFrame + div.NavFrame { border-top-style: none; border-top-style: hidden; } div.NavPic { background-color: #fff; margin: 0px; padding: 2px; float: left; } div.NavFrame div.NavHead { height: 1.6em; font-weight: bold; background-color: #ccf; position:relative; } div.NavFrame p { font-size: 100%; } div.NavFrame div.NavContent { font-size: 100%; } div.NavFrame div.NavContent p { font-size: 100%; } div.NavEnd { margin: 0px; padding: 0px; line-height: 1px; clear: both; } a.NavToggle { position:absolute; top:0px; right:3px; font-weight:normal; font-size:smaller; } /* Class for links with loudspeaker icon next to them */ .audiolink a{ background: url("//upload.wikimedia.org/wikipedia/commons/f/f7/Loudspeaker.png") center left no-repeat !important; padding-left: 16px !important; padding-right: 0 !important; } /* Icons for medialist templates [[Template:Listen]], [[Template:Multi-listen_start]], [[Template:Video]], [[Template:Multi-video_start]] */ div.listenlist { background: url("//upload.wikimedia.org/wikipedia/commons/thumb/a/a6/Gnome-speakernotes.png/30px-Gnome-speakernotes.png"); padding-left: 40px; } div.videolist { background: url("//upload.wikimedia.org/wikipedia/commons/thumb/0/0e/Video.svg/40px-Video.svg.png"); padding-left: 50px; } div.multivideolist { background: url("//upload.wikimedia.org/wikipedia/en/thumb/7/7a/FilmRoll-small.png/40px-FilmRoll-small.png"); padding-left: 50px; } /* Style rules for media list templates */ div.medialist { min-height: 50px; margin: 1em; background-position: top left; background-repeat: no-repeat; } div.medialist ul { list-style-type: none; list-style-image: none; margin: 0; } div.medialist ul li { padding-bottom: 0.5em; } div.medialist ul li li { font-size: 91%; padding-bottom: 0; } /* Content in columns with CSS instead of tables [[Template:Columns]] */ div.columns-2 div.column { float: left; width: 50%; min-width: 300px; } div.columns-3 div.column { float: left; width: 33.3%; min-width: 200px; } div.columns-4 div.column { float: left; width: 25%; min-width: 150px; } div.columns-5 div.column { float: left; width: 20%; min-width: 120px; } /*Add formatting to make sure that "external references" from [[Template:Ref]] do not get URL expansion, not even when printed. The mechanism up to MediaWiki 1.4 was that the HTML code contained a SPAN following the anchor A; this SPAN had the class "urlexpansion", which was not displayed on screen, but was shown when the medium was "print". The rules below ensure (a) that there is no extra padding to the right of the anchor (displayed as "[<number>]"), (b) that there is no "external link arrow" for the link, and (c) that this SPAN of class "urlexpansion" is never shown. ~~~~ */ .plainlinksneverexpand { background: none ! important; padding: 0 ! important; } .plainlinksneverexpand .urlexpansion { display: none ! important; } /* Make sure that ext links displayed within "plainlinksneverexpand" don't get the arrow... */ .plainlinksneverexpand a { background: none !important; padding: 0 !important; } /* With MediaWiki 1.5, the mechanism has changed: instead of a SPAN of class "urlexpansion" following the anchor A, the anchor itself now has class "external autonumber" and the expansion is inserted when printing (see the common printing style sheet at //en.wikipedia.org/w/skins/common/commonPrint.css) using the ":after" pseudo- element of CSS. We have to switch this off for links due to Template:Ref! ~~~~ */ .plainlinksneverexpand a.external.text:after { display: none !important; } .plainlinksneverexpand a.external.autonumber:after { display: none !important; } /* Messagebox templates */ .messagebox { border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 80%; margin: 0 auto 1em auto; padding: .2em; text-align: justify; } .messagebox.merge { border: 1px solid #c0b8cc; background-color: #f0e5ff; text-align: center; } .messagebox.cleanup { border: 1px solid #9f9fff; background-color: #efefff; text-align: center; } .messagebox.standard-talk { border: 1px solid #c0c090; background-color: #f8eaba; } /* Infobox template style */ .infobox { border: 1px solid #aaaaaa; background-color: #f9f9f9; color: black; margin-bottom: 0.5em; margin-left: 1em; padding: 0.2em; float: right; clear: right; } .infobox td, .infobox th { vertical-align: top; } .infobox caption { font-size: larger; margin-left: inherit; } .infobox.bordered { border-collapse: collapse; } .infobox.bordered td, .infobox.bordered th { border: 1px solid #aaaaaa; } .infobox.bordered .borderless td, .infobox.bordered .borderless th { border: 0; } .infobox.sisterproject { width: 20em; font-size: 90%; } /* Put a checker background at the image description page only visible if the image has transparent background */ #file img {background: url("//upload.wikimedia.org/wikipedia/commons/5/5d/Checker-16x16.png") repeat;} /* Support for Template:IPA, Template:Unicode and Template:Polytonic. The inherit declaration resets the font for all browsers except MSIE6. The empty comment must remain. */ .IPA { font-family: Chrysanthi Unicode, Doulos SIL, Gentium, GentiumAlt, Code2000, TITUS Cyberbit Basic, DejaVu Sans, Bitstream Vera Sans, Bitstream Cyberbit, Arial Unicode MS, Lucida Sans Unicode, Hiragino Kaku Gothic Pro, Matrix Unicode; font-family /**/:inherit; } .Unicode { font-family: TITUS Cyberbit Basic, Code2000, Doulos SIL, Chrysanthi Unicode, Bitstream Cyberbit, Bitstream CyberBase, Bitstream Vera, Thryomanes, Gentium, GentiumAlt, Visual Geez Unicode, Lucida Grande, Arial Unicode MS, Microsoft Sans Serif, Lucida Sans Unicode; font-family /**/:inherit; } .polytonic { font-family: Athena, Gentium, Palatino Linotype, Arial Unicode MS, Lucida Sans Unicode, Lucida Grande, Code2000; font-family /**/:inherit; } #wpSave { font-weight: bold; } /* hiddenStructure from Monobook - allows selective hiding of markup in templates */ .hiddenStructure { display: none; speak: none; } /* Removes underlines from links */ .nounderlines a { text-decoration: none; } /* CSS for testing a new Main Page design, see [[Wikipedia:WikiProject Usability/Main Page]] */ #EnWpMainPage { width: 100%; margin-top: 1em; } #EnWpMainPage h2 { font-size: 130%; font-weight: bold; margin: 0; padding: 0; border: 0; } #EnWpMpMargin { margin-right: 13.8em; } #EnWpMpCol1 { float: left; clear: left; width: 50%; } #EnWpMpCol2 { width: 49.9%; float: left; } #EnWpMpBrowse { background: #f8fcff url(//upload.wikimedia.org/wikipedia/en/9/9f/MP-three-books.png) no-repeat 180% 9%; border: 1px solid #c7c7c7; } #EnWpMpBrowseCats li { font-size: 85%; margin-left: 1em; line-height: 1.5; } #EnWpMpBrowseCats h3 { font-size: 120%; margin: .2em 0 .1em -.8em; padding: 0; font-weight: normal; } #EnWpMpBrowseCats h3 a { font-weight: bold; } #EnWpMpBook { background-image: url(//upload.wikimedia.org/wikipedia/en/7/7e/MP-open-book.png); } #EnWpMpFeaturedPic { text-align: center; margin: 0 0 .5em; font-size: 85%; font-weight: bold; } #EnWpMpFeaturedPic h2 { font-size: 145%; text-align: left; } .EnWpMpBrowseRight { float: right; width: 12.7em; } .EnWpMpBrowseBottom { margin: 1em 0; } .EnWpMpBrowseBottom #EnWpMpBrowseCats li, .EnWpMpBrowseBottom #EnWpMpUsefulLinks, .EnWpMpBrowseBottom #EnWpMpFeaturedPic { float: left; width: 24%; margin: 0; line-height: normal; } .EnWpMpBrowseBottom #EnWpMpBrowseCats h3 { margin-left: 0; } #EnWpMpUsefulLinks { clear: left; } #EnWpMpSearch { background: url(//upload.wikimedia.org/wikipedia/en/a/ae/MP-magnifying-glass.png) no-repeat top right; } #EnWpMpSearch input { vertical-align: middle; } #EnWpMpSearchInner { float: right; width: 20em; text-align: center; } #bodySearchMP { margin: 0; padding: 0; } #bodySearchMP .bodySearchWrap { float: right; width: 17.5em; text-align: left; padding: .8em 0; } #bodySearchMP label { display: block; font-size: 95%; font-weight: bold; margin-bottom: -.2em; } #bodySearchMP .bodySearchBtnGo { font-weight: bold; padding-left: .3em; padding-right: .3em; margin-left: .5em; } .EnWpMpContentBox { border: 1px solid; margin-bottom: .9em; } #EnWpMpCol2 .EnWpMpContentBox { margin-left: .9em; } .EnWpMpImage { float: right; margin: 0 0 .2em .2em; } .EnWpMpImage img { position: relative; z-index: 3; } #EnWpMpSisterProjects { float: left; width: 49%; } .EnWpMpSisterProject { float: left; width: 17em; margin: 0; height: 5.5em; margin: 0; } .EnWpMpSisterImg { float: left; width: 40px; height: 100%; } #EnWpMpOtherLangs { margin-left: 50%; } #EnWpMainPageNoCSS { display: none; } #EnWpMpBook2 { background-image: url(//upload.wikimedia.org/wikipedia/en/8/8e/MP-open-book2.png); } #EnWpMpSearch2 { background: url(//upload.wikimedia.org/wikipedia/en/3/3a/MP-magnifying-glass2.png) no-repeat top right; } /* Custom link colors for use in [[MediaWiki:Edittools]] */ .charboxblack a:link, .charboxblack a:hover, .charboxblack a:visited, .charboxblack a:active { color: black; } .charboxsilver a:link, .charboxsilver a:hover, .charboxsilver a:visited, .charboxsilver a:active { color: silver; } .charboxgray a:link, .charboxgray a:hover, .charboxgray a:visited, .charboxgray a:active { color: gray; } .charboxwhite a:link, .charboxwhite a:hover, .charboxwhite a:visited, .charboxwhite a:active { color: white; } .charboxmaroon a:link, .charboxmaroon a:hover, .charboxmaroon a:visited, .charboxmaroon a:active { color: maroon; } .charboxred a:link, .charboxred a:hover, .charboxred a:visited, .charboxred a:active { color: red; } .charboxpurple a:link, .charboxpurple a:hover, .charboxpurple a:visited, .charboxpurple a:active { color: purple; } .charboxfuchsia a:link, .charboxfuchsia a:hover, .charboxfuchsia a:visited, .charboxfuchsia a:active { color: fuchsia; } .charboxgreen a:link, .charboxgreen a:hover, .charboxgreen a:visited, .charboxgreen a:active { color: green; } .charboxlime a:link, .charboxlime a:hover, .charboxlime a:visited, .charboxlime a:active { color: lime; } .charboxolive a:link, .charboxolive a:hover, .charboxolive a:visited, .charboxolive a:active { color: olive; } .charboxyellow a:link, .charboxyellow a:hover, .charboxyellow a:visited, .charboxyellow a:active { color: yellow; } .charboxnavy a:link, .charboxnavy a:hover, .charboxnavy a:visited, .charboxnavy a:active { color: navy; } .charboxblue a:link, .charboxblue a:hover, .charboxblue a:visited, .charboxblue a:active { color: blue; } .charboxteal a:link, .charboxteal a:hover, .charboxteal a:visited, .charboxteal a:active { color: teal; } .charboxaqua a:link, .charboxaqua a:hover, .charboxaqua a:visited, .charboxaqua a:active { color: aqua; } /* Pilot database table formatting, specifically for [[Database normalization]] but could be generalized */ table.database {border-bottom:1px solid #779;margin-bottom:1em;} table.database caption {text-align:left;font-weight:bold;font-size:11pt; margin-left:0.4em;margin-top:1em;} table.database th {background-color:#779;padding:0 0.6em;font-weight:bold; color:#FFF;} table.database td {border-top:1px solid #779;padding:0 0.6em} /* put scrollbar on pre sections instead of ugly cutoff/overlap in firefox */ pre { overflow: auto; } /* TITRES */ /* Interligne suffisant si le titre prend plusieurs lignes. */ .firstHeading { line-height:1.2em } /* Décoration des titres de sous-chapitre. */ h3 { border-bottom:dotted 1px #AAA } h4, h5, h6 { border-bottom:dotted 1px #DDD } /* Change the external link icon to an Adobe icon for all PDF files */ /* (in browsers that support these CSS selectors, like Mozilla and Opera) */ #bodyContent a[href$=".pdf"].external, #bodyContent a[href*=".pdf?"].external, #bodyContent a[href*=".pdf#"].external, #bodyContent a[href$=".PDF"].external, #bodyContent a[href*=".PDF?"].external, #bodyContent a[href*=".PDF#"].external { background: url(//upload.wikimedia.org/wikipedia/commons/thumb/2/23/Icons-mini-file_acrobat.gif/15px-Icons-mini-file_acrobat.gif) center right no-repeat; padding-right: 16px; } /* Change the external link icon to an Adobe icon anywhere the PDFlink class */ /* is used (notably Template:PDFlink). This works in IE, unlike the above. */ span.PDFlink a { background: url(//upload.wikimedia.org/wikipedia/commons/thumb/2/23/Icons-mini-file_acrobat.gif/15px-Icons-mini-file_acrobat.gif) center right no-repeat !important; padding-right: 17px !important; } span.geolink a { background: url(//upload.wikimedia.org/wikipedia/en/a/a7/Monobook-globe.png) center right no-repeat !important; padding-right: 11px !important; } /* Highlight clicked reference in blue to help navigation */ ol.references > li:target { background-color: #DEF; } sup.reference:target { background-color: #DEF; } /* Styling for Citations */ cite { font-style: normal; word-wrap: break-word; } /* If there is an inline link to a full citation, the full citation will turn blue when the inline link is clicked */ cite:target { background-color: #DEF; } /* styles for geography infoboxes, e.g. countries, country subdivisions, cities, etc. */ .infobox.geography { text-align: left; border-collapse: collapse; line-height: 1.2em; font-size: 90%; } .infobox.geography td, .infobox.geography th { border-top: solid 1px #aaa; padding: 0.4em 0.6em 0.4em 0.6em; } .infobox.geography .mergedtoprow td, .infobox.geography .mergedtoprow th { border-top: solid 1px #aaa; padding: 0.4em 0.6em 0.2em 0.6em; } .infobox.geography .mergedrow td, .infobox.geography .mergedrow th { border: 0; padding: 0 0.6em 0.2em 0.6em; } .infobox.geography .mergedbottomrow td, .infobox.geography .mergedbottomrow th { border-top: 0; border-bottom: solid 1px #aaa; padding: 0 0.6em 0.4em 0.6em; } .infobox.geography .maptable td, .infobox.geography .maptable th { border: 0; padding: 0; } /* Style for "notices" */ .notice { margin: 1em; padding: 0.2em; } #disambig { border-top: 1px solid #ccc; border-bottom: 1px solid #ccc; } .spoiler { border-top: 2px solid #ddd; border-bottom: 2px solid #ddd; } /* Versteek MediaWiki:Tagline tensy anders vermeld. */ body #siteSub { display: none !important; } /* verschil in recente wijzigingen in rood en groen */ .mw-plusminus-pos { color:green; } .mw-plusminus-neg { color: #8B0000; } /* Interwiki-skakels na voorbladartikels in anderstalige Wikibooks verskyn met 'n geel ster in plaas van die normale koeël. Sien [[Sjabloon:Link FA]]. */ .portlet li { list-style-image: url("//upload.wikimedia.org/wikipedia/commons/1/18/Monobook-bullet.png"); } li.FA { list-style-image: url("//upload.wikimedia.org/wikipedia/en/d/d4/Monobook-bullet-star.png"); } /*</nowiki></pre>*/ 86i6q276zdh96j0jcl4wats87f5vblq MediaWiki:Upload.js 8 2007 4645 3657 2013-04-15T12:21:30Z Ruslik0 363 update 4645 javascript text/javascript /***** loadAutoInformationTemplate ******** * Adds a link to subpages of current page * * Maintainers: [[:commons:User:Yonidebest]], [[:commons:User:Dschwen]] * Adapted from [[:commons:MediaWiki:Upload.js]] by [[User:Siebrand]] ****/ function loadAutoInformationTemplate() { uploadDescription = document.getElementById('wpUploadDescription'); var doubleBracket = '{' + '{'; uploadDescription.value = doubleBracket + 'Beeldinligting\n|beskrywing=\n|bron=\n|datum=\n|daarsteller=\n|outeur=\n|ander_weergawes=\n}}\n<!-- VERPLIG: Moenie vergeet om n lisensie te kies ASOOK n bron EN n outeur in te vul nie! -->'; } $(document).ready(loadAutoInformationTemplate); fnmsg1i2m3eppnsirgppupjqnvofix7 MediaWiki:Common.js 8 2008 7156 7153 2022-01-15T21:43:39Z Taavi 2194 remove unused logging code breaking the search bar ([[phab:T299282]]) 7156 javascript text/javascript /* Any JavaScript here will be loaded for all users on every page load. */ function insertTagsTo_(tagOpen, tagClose, sampleText, outputid) { var txtarea = document.getElementById(outputid); if (!txtarea) return ; // IE if (document.selection) { var theSelection = document.selection.createRange().text; if (!theSelection) theSelection=sampleText; txtarea.focus(); if (theSelection.charAt(theSelection.length - 1) == " ") { // exclude ending space char, if any theSelection = theSelection.substring(0, theSelection.length - 1); document.selection.createRange().text = tagOpen + theSelection + tagClose + " "; } else { document.selection.createRange().text = tagOpen + theSelection + tagClose; } // Mozilla } else if(txtarea.selectionStart || txtarea.selectionStart == '0') { var replaced = false; var startPos = txtarea.selectionStart; var endPos = txtarea.selectionEnd; if (endPos-startPos) replaced = true; var scrollTop = txtarea.scrollTop; var myText = (txtarea.value).substring(startPos, endPos); if (!myText) myText=sampleText; if (myText.charAt(myText.length - 1) == " ") { // exclude ending space char, if any subst = tagOpen + myText.substring(0, (myText.length - 1)) + tagClose + " "; } else { subst = tagOpen + myText + tagClose; } txtarea.value = txtarea.value.substring(0, startPos) + subst + txtarea.value.substring(endPos, txtarea.value.length); txtarea.focus(); //set new selection if (replaced) { var cPos = startPos+(tagOpen.length+myText.length+tagClose.length); txtarea.selectionStart = cPos; txtarea.selectionEnd = cPos; } else { txtarea.selectionStart = startPos+tagOpen.length; txtarea.selectionEnd = startPos+tagOpen.length+myText.length; } txtarea.scrollTop = scrollTop; } // reposition cursor if possible if (txtarea.createTextRange) txtarea.caretPos = document.selection.createRange().duplicate(); } /* </pre> == Autotekst in uploadpagina voor bestanden == Description: Script voor Speciaal:Uploaden Maintainers: [[:commons:User:Yonidebest]], [[:commons:User:Dschwen]] <pre> */ if (mw.config.get('wgCanonicalSpecialPageName')==='Upload') { mw.loader.load( '/w/index.php?title=MediaWiki:Upload.js&action=raw&ctype=text/javascript' ); } /** Extra toolbar options ****************************************************** <nowiki> * * Description: UNDOCUMENTED * Maintainers: [[User:MarkS]]?, [[User:Voice of All]], [[User:R. Koot]] */ /* == Small search keyboard == ; Author: Maciej Jaros [[:pl:User:Nux]] ; Licence: CC-BY or [http://opensource.org/licenses/gpl-license.php GNU General Public License v2] */ if (mw.config.get('wgCanonicalSpecialPageName') == "Search") { jQuery(document).ready(addSearchKeyboards); } function addSearchKeyboards() { if (document.forms['search']) addSearchKeyboard(document.forms['search']); if (document.forms['powersearch']) addSearchKeyboard(document.forms['powersearch']); } function addSearchKeyboard(searchForm) { var searchBoxId = 'lsearchbox'; if (!searchForm.lsearchbox) { if (searchForm.search.id == '') { searchBoxId = searchForm.name + 'box'; searchForm.search.id = searchBoxId; } else searchBoxId = searchForm.search.id; } var letters = new Array('ä', 'å', 'ç', 'è', 'é', 'ë', 'ê', 'ï', 'î', 'ö', 'ô', 'ß', 'ü', 'û'); var html = "Sleutelbord: "; for (var i = 0; i < letters.length; i++) { html += "<a onclick=\"insertTagsTo_('" + letters[i] + "','','','" + searchBoxId + "');return false\" href=\"#\">" + letters[i] + "</a>"; } var newEl = document.createElement('div'); newEl.className = 'search_keyboard'; newEl.innerHTML = html; newEl.style.cssText = 'width:50%; font-size:small; font-weight: bold'; document.getElementById(searchBoxId).parentNode.appendChild(newEl); } /** Change Special:Search to use a drop-down menu * * Description: Dodaje do strony Special:Search menu rozwijane * pozwalające na wybór wyszukiwarki * Created by: [[en:User:Gracenotes]] */ if (mw.config.get('wgCanonicalSpecialPageName') == "Search") { var searchEngines = []; jQuery(document).ready(SpecialSearchEnhanced); } function SpecialSearchEnhanced() { var createOption = function(site, action, mainQ, addQ, addV) { var opt = document.createElement('option'); opt.appendChild(document.createTextNode(site)); searchEngines[searchEngines.length] = [action, mainQ, addQ, addV]; return opt; } var searchForm; if (document.forms['search']) searchForm = document.forms['search']; else if (document.forms['powersearch']) searchForm = document.forms['powersearch']; if (searchForm.lsearchbox) { var searchBox = searchForm.lsearchbox; } else { var searchBox = searchForm.search; } var selectBox = document.createElement('select'); selectBox.id = 'searchEngine'; searchForm.onsubmit = function() { var optSelected = searchEngines[document.getElementById('searchEngine').selectedIndex]; searchForm.action = optSelected[0]; searchBox.name = optSelected[1]; searchForm.title.value = optSelected[3]; searchForm.title.name = optSelected[2]; } selectBox.appendChild(createOption('MediaWiki', mw.config.get('wgScriptPath') + '/index.php', 'search', 'title', 'Special:Search')); selectBox.appendChild(createOption('Google', 'http://www.google.co.za/search', 'q', 'sitesearch', 'af.wikipedia.org')); selectBox.appendChild(createOption('Yahoo', 'http://search.yahoo.com/search', 'p', 'vs', 'af.wikipedia.org')); selectBox.appendChild(createOption('Windows Live', 'http://search.live.com/results.aspx', 'q', 'q1', 'site://af.wikipedia.org')); selectBox.appendChild(createOption('Wikiwix', 'http://af.wikiwix.com/', 'action', 'lang', 'af')); searchBox.style.marginLeft = '0px'; if (document.getElementById('loadStatus')) { var lStat = document.getElementById('loadStatus'); } else { var lStat = searchForm.fulltext; } lStat.parentNode.insertBefore(selectBox, lStat); } /* Plasing van [wysig]-skakel --------------------------- Correction des titres qui s'affichent mal en raison de limitations dues à MediaWiki. Copyright 2006, Marc Mongenet. Licence GPL et GFDL. The function looks for <span class="editsection">, and move them at the end of their parent and display them inline in small font. var oldEditsectionLinks=true disables the function. */ function setModifySectionStyle() { try { if (!(typeof oldEditsectionLinks == 'undefined' || oldEditsectionLinks == false)) return; var spans = document.getElementsByTagName("span"); for (var s = 0; s < spans.length; ++s) { var span = spans[s]; if (span.className == "editsection") { span.style.fontSize = "xx-small"; span.style.fontWeight = "normal"; span.style.cssFloat = span.style.styleFloat = "none"; span.parentNode.appendChild(document.createTextNode(" ")); span.parentNode.appendChild(span); } } } catch (e) { /* something went wrong */ } } jQuery(document).ready(setModifySectionStyle); /* </pre> == Uitgelicht in andere talen == Sterren voor interwikilinks van de [[Wikipedia:Etalage]]-artikelen van andere Wikipedia's. Zie {{tl|Link FA}}. Overgenomen van [[:de:MediaWiki:Common.js]] Om deze functie uit te zetten, zet <code>enable_linkFA = false;</code> in [[Special:Mypage/monobook.js]]. <pre> */ var enable_linkFA = true; function linkFA() { if (!enable_linkFA) return; // links are to replaced in p-lang only var pLang = document.getElementById("p-lang"); if (!pLang) { return; } var lis = pLang.getElementsByTagName("li"); for (var i=0; i<lis.length; i++) { var li = lis[i]; // alleen links met een Link FA-sjabloon if (!document.getElementById(li.className + "-fa")) continue; // Extra css-klasse zodat het effect verborgen kan worden met CSS li.className += " FA"; // Verander titel li.title = "Hierdie is 'n voorbladartikel in 'n ander taal."; } } jQuery(document).ready(linkFA); /* </pre> /** WikiMiniAtlas ******************************************************* * * Description: WikiMiniAtlas is a popup click and drag world map. * This script causes all of our coordinate links to display the WikiMiniAtlas popup button. * The script itself is located on meta because it is used by many projects. * See [[Meta:WikiMiniAtlas]] for more information. * Maintainers: [[User:Dschwen]] */ mw.loader.load('//meta.wikimedia.org/w/index.php?title=MediaWiki:Wikiminiatlas.js&action=raw&ctype=text/javascript&smaxage=21600&maxage=86400'); sxzt8h7acsg24aggk1x4nxsykakybud MediaWiki:Deletereason-dropdown 8 2009 3660 2008-11-23T14:55:32Z Adriaan90 190 edit 3660 wikitext text/x-wiki *Algemene redes ** Aanstuur stukkend ** Advertensie ** Bloginskrywing ** Foutiewe titel ** Geen inhoud ** Inhoud in 'n ander taal ** Inhoud onbegryplik ** Kategorie leeg ** Kategorie verouderd ** Kopieregskending ** Rekenaarvertaalde inhoud ** Sjabloon ongebruik ** Sjabloon verouderd ** Totale onsin ** Vandalisme ** Woordeboekinskrywing kylfa05p516oxl9ry6e42uasxmnn6v5 Gebruiker:Erwin/monobook.js 2 2010 6793 3662 2021-02-04T23:27:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6793 javascript text/javascript // [[:m:User:Erwin/global.js]] mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Erwin/global.js&action=raw&ctype=text/javascript'); 281bkaieaosxcl4smmex56z22y3ma9c MediaWiki:Monobook.css 8 2011 4550 3664 2012-08-24T23:23:58Z Hoo man 599 Removing obsolete diff style declarations 4550 css text/css /*<pre><nowiki>*/ /* Senkinskakel word uitgekommentaar wanneer daar fonsinsamelings aan die gang is. */ #siteNotice { margin-top:5px; padding-left: 4px; font-style: italic; text-align: center; } /****************************/ /* BEGIN LIGHT BLUE SECTION */ /****************************/ /* Make all non-namespace pages have a light blue content area. This is done by setting the background color for all #content areas to light blue and then overriding it for any #content enclosed in a .ns-0 (main namespace). I then do the same for the "tab" background colors. --Lupo */ #content { background: #F8FCFF; /* a light blue */ } #content div.thumb { border-color: #F8FCFF; } .ns-0 * #content { background: white; } #mytabs li { background: #F8FCFF; } .ns-0 * #mytabs li { background: white; } #mytabs li a { background-color: #F8FCFF; } .ns-0 * #mytabs li a { background-color: white; } #p-cactions li a { background-color: #F8FCFF; } .ns-0 * #p-cactions li a { background-color: white; } .ns-0 * #content div.thumb { border-color: white; } /**************************/ /* END LIGHT BLUE SECTION */ /**************************/ /* Display "From Wikipedia, the free encyclopedia" */ #siteSub { display: inline; font-size: 100%; font-weight: normal; } #bodyContent #siteSub a { color: #000; text-decoration: none; background-color: transparent; background-image: none; padding-right: 0; } /* Bold 'edit this page' link to encourage newcomers */ #ca-edit a { font-weight: bold !important; } /* Display "User $1, you are already logged in!" ([[MediaWiki:Alreadyloggedin]]) in red and bold */ div.alreadyloggedin { color: red; font-weight: bold; } @media print { /* Do not print edit link in templates using Template:Ed Do not print certain classes that shouldn't appear on paper */ .editlink, .noprint, .metadata, .dablink { display: none } } /* Style for "notices" */ .notice { text-align: justify; margin: 1em 0.5em; padding: 0.5em; } #disambig { border-top: 3px double #cccccc; border-bottom: 3px double #cccccc; } #pt-login { font-weight: bold; font-size: 110%; } form#userlogin { float: left; padding: 1em 1em .7em 1em; background-color: #ffffe6; border: 2px solid #fc6; color: #000; margin-right: 2em; } form#userlogin table { float: left; background-color: #ffffe6; color: #000; } p.error { font-weight: bold; } /* Class styles */ /* .toccolours added here because version in monobook/main.css wasn't being used by the print style */ .toccolours { border:1px solid #aaaaaa; background-color:#f9f9f9; padding:5px; font-size: 95%; } /* Experiment: slightly fade inactive tabs */ #p-cactions a { filter: alpha(opacity=90); } #p-cactions a:hover, #p-cactions .selected a { filter: none; } #p-nav h5 { display: none; } .portlet a { text-decoration: none; } .portlet a:hover { text-decoration: underline; } #p-nav .pBody { padding-right: 0; } #p-nav a { display: block; width: 100%; } /* Special characters list below edit window works better without underlining */ #editpage-specialchars a { text-decoration: none; } #editpage-specialchars a:hover { text-decoration: underline; } /* If you don't want to see special characters list at all, put the following line in your User:You/monobook.css file (and remove the slash-asterisk comments) */ /* #editpage-specialchars { display: none; } */ /* Laat aansture anders vertoon op [[Spesiaal:Allpages]] en [[Spesiaal:Prefixindex]] ens.*/ .allpagesredirect { font-style: italic; } /* Laat ruimte oop links van 'n tabel */ table { margin-left: 10px; } /* Standard Navigationsleisten, aka box hiding thingy from .de.*/ div.Boxmerge, div.NavFrame { margin: 0px; padding: 2px; border: 1px solid #aaaaaa; text-align: center; border-collapse: collapse; font-size: 95%; } div.Boxmerge div.NavFrame { border-style: none; border-style: hidden; } div.NavFrame + div.NavFrame { border-top-style: none; border-top-style: hidden; } div.NavPic { background-color: #ffffff; margin: 0px; padding: 2px; float: left; } div.NavFrame div.NavHead { height: 1.6em; font-weight: bold; font-size: 100%; background-color: #efefef; position:relative; } div.NavFrame p { font-size: 100%; } div.NavFrame div.NavContent { font-size: 100%; } div.NavFrame div.NavContent p { font-size: 100%; } div.NavEnd { margin: 0px; padding: 0px; line-height: 1px; clear: both; } a.NavToggle { position:absolute; top:0px; right:3px; font-weight:normal; font-size:smaller; } #coordinates { position:absolute; z-index:1; border:none; background:none; right:30px; top:3.7em; float:right; margin:0.0em; padding:0.0em; line-height:1.5em; text-align:right; text-indent:0; font-size:85%; text-transform:none; white-space:nowrap; } /* search keyboard settings */ .search_keyboard a { padding: 0px 3px; border: 1px outset #ddd; } .search_keyboard a:hover { border: 1px inset #ddd; } /* Kleurskemas vir spesifieke naamruimtes La couleur des pages de discussion n'est pas changée. */ #content, #p-cactions li, #p-cactions li a { background:#f5faff } /* Spesiaal */ .ns--1 #content, .ns--1 #p-cactions li, .ns--1 #p-cactions li a { background:#F8FCFF } /* main */ .ns-0 * #content, .ns-0 * #p-cactions li, .ns-0 * #p-cactions li a { background:#FFF } /* Utilisateur */ .ns-2 * #content, .ns-2 * #p-cactions li, .ns-2 * #p-cactions li a { background:#FFF } /* Wikipédia */ .ns-4 * #content, .ns-4 * #p-cactions li, .ns-4 * #p-cactions li a { background:#f5faff } /* Beeld */ .ns-6 * #content, .ns-6 * #p-cactions li, .ns-6 * #p-cactions li a { background:#FFF } /* MediaWiki */ .ns-8 * #content, .ns-8 * #p-cactions li, .ns-8 * #p-cactions li a { background:#faf5ff } /* Modèle */ .ns-10 * #content, .ns-10 * #p-cactions li, .ns-10 * #p-cactions li a { background:#FFF } /* Aide */ .ns-12 * #content, .ns-12 * #p-cactions li, .ns-12 * #p-cactions li a { background:#F8FCFF } /* Test, voir [[Wikipédia:Le Bistro/4 octobre 2007]] */ /* Kategorie */ .ns-14 * #content, .ns-14 * #p-cactions li, .ns-14 * #p-cactions li a { background:#FFF } /* Portail */ .ns-100 * #content, .ns-100 * #p-cactions li, .ns-100 * #p-cactions li a { background:#FFF } /* Projet */ .ns-102 * #content, .ns-102 * #p-cactions li, .ns-102 * #p-cactions li a { background:#d9ffd9 } /* Référence */ .ns-104 * #content, .ns-104 * #p-cactions li, .ns-104 * #p-cactions li a { background:#EFE } /*</nowiki></pre>*/ s0rm661zuj5i2gvg9fmqqi69m1ufbha Gebruiker:Joystick 2 2012 3668 2008-12-15T05:00:07Z Joystick 267 Nuwe blad: __NOTOC__ __NOEDITSECTION__ {| | style="direction: ltr; border: 1px solid #cccccc; padding: 6pt 12px 12pt 12pt; vertical-align: top; background-color: #ffffff" | <div style="float: righ... 3668 wikitext text/x-wiki __NOTOC__ __NOEDITSECTION__ {| | style="direction: ltr; border: 1px solid #cccccc; padding: 6pt 12px 12pt 12pt; vertical-align: top; background-color: #ffffff" | <div style="float: right; padding-right: 0.5em; padding-top: 3px">[[Image:Nuvola apps package games arcade.png|40px|Wiki]]</div> == joystick == <div class="plainlinks" style="margin: 0 auto; width: 250px"> {| width=100% style="background-color: #ffffff" |- | [http://toolserver.org/~vvv/sulutil.php?user=Joystick&rights=1 SUL] |- | [http://pl.wikimedia.org/wiki/Użytkownik:Joystick Polish chapter] |- | [http://pl.wiktionary.org/wiki/Wikipedysta:Joystick Home Wiki] • [http://pl.wiktionary.org/wiki/Dyskusja_Wikipedysty:Joystick Talk] |- |} </div> |} cnajrrebm8u00dgmfbvcwf916y5qdfi Gebruiker:Nikkis 2 2013 4859 4858 2014-05-17T09:24:31Z Stryn 1190 Wysigings deur [[Special:Contributions/94.229.66.67|94.229.66.67]] teruggerol na laaste weergawe deur [[User:Aldnonymous|Aldnonymous]] 4859 wikitext text/x-wiki {| style="background:#FFFFFF;" |width=75% valign="top" | <big><center><span class="hintergrundfarbe5"> '''Dieser Benutzer spricht Deutsch''' </span></center></big> <big><center><span class="hintergrundfarbe5"> '''This user speaks English''' <big><center><span class="hintergrundfarbe5"> '''Cet utilisateur parle français''' <big><center><span class="hintergrundfarbe5"> '''Hic usuarius simplici Latinitate contribuere potest''' {| style="background:#E8E8E8;" |width=75% valign="top" | '''Home wiki: [[w:de:Wikipedia:Hauptseite|German-language edition of Wikipedia]]''' Outstanding post, you have pointed out some fantastic points, I as well think this is a very great website. cedbkgkdedkckdek == Sister projects == <div class="inhalt" align="center"> <span style="white-space:nowrap;"><span class="icon">[[Image:Wikipedia-logo.png|20px]]&nbsp;</span>[[w:User:Nikkis|Wikipedia]]&nbsp;–&nbsp;Encyclopedia&nbsp;&nbsp;&nbsp;&nbsp;</span> <span style="white-space:nowrap;"><span class="icon">[[Image:Wiktionary-ico-de.png|20px]]&nbsp;</span>[[wikt:User:Nikkis|Wiktionary]]&nbsp;–&nbsp;Dictionary&nbsp;&nbsp;&nbsp;&nbsp;</span> <span style="white-space:nowrap;"><span class="icon">[[Image:Wikiquote-logo.svg|20px]]&nbsp;</span>[[q:User:Nikkis|Wikiquote]]&nbsp;–&nbsp;Collection of quotations&nbsp;&nbsp;&nbsp;&nbsp;</span> <span style="white-space:nowrap;"> </span> </div> == Wikibooks in other languages == <div class="inhalt" align="center"> <span style="white-space:nowrap;"> [[Image:Wikibooks-logo.svg|100px|Wikibooks]]<br> [[:af:User:Nikkis|Afrikaans]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ang:User:Nikkis|Anglo-Saxon]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ar:User:Nikkis|العربية]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ast:User:Nikkis|Asturianu]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:az:User:Nikkis|Azərbaycan]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:be:User:Nikkis|Беларуская]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:bg:User:Nikkis|Български]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:bn:User:Nikkis|বাংলা]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:bs:User:Nikkis|Bosanski]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ca:User:Nikkis|Català]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:co:User:Nikkis|Corsu]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:cs:User:Nikkis|Česky]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:cv:User:Nikkis|Чăвашла]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:cy:User:Nikkis|Cymraeg]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:da:User:Nikkis|Dansk]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:de:User:Nikkis|Deutsch]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:el:User:Nikkis|Ελληνικά]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:en:User:Nikkis|English]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:eo:User:Nikkis|Esperanto]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:es:User:Nikkis|Español]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:et:User:Nikkis|Eesti]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:eu:User:Nikkis|Euskara]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:fa:User:Nikkis|فارسی]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:fi:User:Nikkis|Suomi]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:fr:User:Nikkis|Français]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:fy:User:Nikkis|Frysk]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:gl:User:Nikkis|Galego]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:he:User:Nikkis|עברית]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:hi:User:Nikkis|हिन्दी]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:hr:User:Nikkis|Hrvatski]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:hu:User:Nikkis|Magyar]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:hy:User:Nikkis|Հայերեն]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ia:User:Nikkis|Interlingua]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:id:User:Nikkis|Bahasa Indonesia]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ie:User:Nikkis|Interlingue]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:is:User:Nikkis|Íslenska]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:it:User:Nikkis|Italiano]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ja:User:Nikkis|日本語]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ka:User:Nikkis|ქართული]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:kk:User:Nikkis|Қазақша]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:km:User:Nikkis|ភាសាខ្មែរ]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:kn:User:Nikkis|ಕನ್ನಡ]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ko:User:Nikkis|한국어]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ku:User:Nikkis|Kurdî / كوردی]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ky:User:Nikkis|Кыргызча]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:la:User:Nikkis|Latina]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:lb:User:Nikkis|Lëtzebuergesch]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:lt:User:Nikkis|Lietuvių]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:lv:User:Nikkis|Latviešu]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:mg:User:Nikkis|Malagasy]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:mk:User:Nikkis|Македонски]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ml:User:Nikkis|മലയാളം]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:mn:User:Nikkis|Монгол]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:mr:User:Nikkis|मराठी]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ms:User:Nikkis|Bahasa Melayu]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:na:User:Nikkis|Dorerin Naoero]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:nds:User:Nikkis|Plattdüütsch]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ne:User:Nikkis|नेपाली]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:nl:User:Nikkis|Nederlands]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:no:User:Nikkis|‪Norsk (bokmål)]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:oc:User:Nikkis|Occitan]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:pa:User:Nikkis|ਪੰਜਾਬੀ]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:pl:User:Nikkis|Polski]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ps:User:Nikkis|پښتو]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:pt:User:Nikkis|Português]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ro:User:Nikkis|Română]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sa:User:Nikkis|संस्कृत]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:si:User:Nikkis|සිංහල]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:simple:User:Nikkis|Simple English]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sk:User:Nikkis|Slovenčina]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sl:User:Nikkis|Slovenščina]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sq:User:Nikkis|Shqip]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sr:User:Nikkis|Српски / Srpski]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:su:User:Nikkis|Basa Sunda]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sv:User:Nikkis|Svenska]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:sw:User:Nikkis|Kiswahili]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ta:User:Nikkis|தமிழ்]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:te:User:Nikkis|తెలుగు]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:tg:User:Nikkis|Тоҷикӣ]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:th:User:Nikkis|ไทย]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:tk:User:Nikkis|Türkmen]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:tl:User:Nikkis|Tagalog]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:tr:User:Nikkis|Türkçe]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:tt:User:Nikkis|Tatarça/Татарча]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:uk:User:Nikkis|Українська]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:ur:User:Nikkis|اردو]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:uz:User:Nikkis|O'zbek]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:vi:User:Nikkis|Tiếng Việt]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:vo:User:Nikkis|Volapük]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:wa:User:Nikkis|Walon]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:xh:User:Nikkis|isiXhosa]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:za:User:Nikkis|(Cuengh)]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:zh:User:Nikkis|中文]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:zh-min-nan:User:Nikkis|Bân-lâm-gú]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> [[:zu:User:Nikkis|isiZulu]]&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;</span> </span> <br> ---- ‣ ''[[m:User:Nikkis|Overview]]'' 35wxkg9ewdrisap7t5zttxtsv8nep93 Gebruiker:Vangelis 2 2014 3686 3685 2009-02-03T07:19:51Z Vangelis 291 3686 wikitext text/x-wiki [http://nl.wikibooks.org/wiki/Gebruiker:Vangelis Vangelis-NL] 32pbsywvd7pgx822u20090nffi2djtg Gebruiker:Charitwo/monobook.css 2 2016 3689 2009-02-09T03:15:36Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3689 css text/css @import url('http://meta.wikimedia.org/w/index.php?title=User:Charitwo/global.css&action=raw&ctype=text/css'); 55k1dpu4q7mps38uh30m4irteygvs1y Gebruiker:Mardetanha/monobook.js 2 2017 6810 3692 2021-02-04T23:30:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6810 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Mardetanha/remote.js&action=raw&ctype=text/javascript'); mil054uwnua7soaktk866fhhux9c3ib Gebruiker:Kylu/monobook.js 2 2019 6807 3697 2021-02-04T23:29:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6807 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Kylu/global.js&action=raw&ctype=text/javascript'); glpx16mn8jhef7kbbu44p73wosurg5v Gebruiker:Kylu/monobook.css 2 2020 3698 2009-02-22T05:15:12Z Pathoschild 29 + global CSS ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3698 css text/css @import url('http://meta.wikimedia.org/w/index.php?title=User:Kylu/global.css&action=raw&ctype=text/css'); 0n1rjfnphb690oojldgxhzxkdqo9vwb MediaWikibespreking:Common.js 9 2021 3720 3703 2009-03-26T06:18:59Z Melancholie 252 /* Code update of de:wikt:MediaWiki:If-search.js */ 3720 wikitext text/x-wiki == Code update of [[:de:wikt:MediaWiki:If-search.js]] == Note that [[:de:wikt:MediaWiki:If-search.js]] has been updated: Important fix for an [[BugZilla:16823|upcoming DOM change]], plus some optimizations! Please update your code or consider just importing the script instead, like described at [[:de:wikt:MediaWiki:If-search.js/import]]. -- Best regards, [[Gebruiker:Melancholie|Melancholie]] 04:21, 4 Maart 2009 (UTC) :Note that the change has gone live now, your search URL is index.php/searchterm instead of Special:Search now (nonetheless still working, but wrong), thus please update/import the script! --- Best regards, [[Gebruiker:Melancholie|Melancholie]] 06:18, 26 Maart 2009 (UTC) 09y80gljxnzfvo3gwi2umvo5taueoey Gebruiker:WikimediaNotifier/updated 2 2026 3709 2009-03-17T12:48:47Z WikimediaNotifier 248 . 3709 wikitext text/x-wiki {| class="TablePager" style="border-color: #8FAACC !important; min-width: 0 !important;" |- | style="border-color: #8FAACC !important;" | {{{1}}} |} 6civ2nd5r2qn7hd51fhz7e4at7m46fe Gebruiker:Kanonkas/monobook.js 2 2028 6801 3716 2021-02-04T23:28:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6801 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Kanonkas/global.js&action=raw&ctype=text/javascript'); 4cv0noyekhcpehdppxxcij6c7um4agq Gebruiker:OverlordQBot 2 2029 3717 2009-03-22T16:30:36Z OverlordQBot 317 test 3717 wikitext text/x-wiki Hi :) bvewr106ecjkbgu8yjyjpzn1gk53yok Gebruiker:OverlordQ 2 2030 4179 3718 2010-11-26T20:46:43Z Quentinv57 577 Softredirect 4179 wikitext text/x-wiki {{Softredirect|:en:wikipedia:User:OverlordQ}} 1jiwzvgm1i4g5c0zmtun2ntaonmkbd0 Gebruiker:VolkovBot 2 2031 3723 2009-04-03T08:06:43Z VolkovBot 328 info 3723 wikitext text/x-wiki * Botmaster: [[:w:ru:User:Volkov]] ([[:w:ru:User talk:Volkov|talk]]) [[ru:User:VolkovBot]] t6xwjrpcro4wq8rdbyb03auvgczyxjd Gebruikerbespreking:VolkovBot 3 2032 3724 2009-04-03T08:06:52Z VolkovBot 328 info 3724 wikitext text/x-wiki To leave a message, please use [[:w:ru:User talk:VolkovBot]] 6v0394ft8vflguenmh26milbufuy8d9 Gebruiker:Muro de Aguas/monobook.js 2 2033 6813 3725 2021-02-04T23:30:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6813 javascript text/javascript mw.loader.load('https://es.wikipedia.org/w/index.php?title=Usuario:Muro_de_Aguas/monobook-global.js&action=raw&ctype=text/javascript'); kvfip5ihd4blbx19k3odgxwftocsn7q Gebruiker:Finnrind/monobook.js 2 2035 6795 3727 2021-02-04T23:27:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6795 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Finnrind/global.js&action=raw&ctype=text/javascript'); aregtndqm7659aw4tkxjs045t4t02kr Gebruiker:Ivocamp96/monobook.css 2 2036 3728 2009-04-13T00:28:45Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3728 css text/css @import url('http://meta.wikimedia.org/w/index.php?title=User:Ivocamp96/global.css&action=raw&ctype=text/css'); 43zz4399kfzdtq5gwbhe90mev7nv24x Gebruiker:Techman224 2 2038 3730 2009-04-17T22:32:49Z Pathoschild 29 linked to main user page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3730 wikitext text/x-wiki See [[w:en:User:Techman224]]. 3ama84ba3beiyv429pajahjjtr25q9w Gebruiker:Str4nd/monobook.js 2 2039 6820 3731 2021-02-04T23:31:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6820 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Str4nd/global.js&action=raw&ctype=text/javascript'); f6w1cqkn1ajvdewd17hlypbjpskxd9v Gebruiker:Kuvaly/monobook.js 2 2040 6802 3732 2021-02-04T23:28:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6802 javascript text/javascript mw.loader.load('https://cs.wikipedia.org/w/index.php?title=User:Kuvaly/global.js&action=raw&ctype=text/javascript'); lpm0f7l9tjqvfb8xarwkwe3ozc36okp Gebruiker:Juliancolton/monobook.js 2 2041 6800 3733 2021-02-04T23:28:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6800 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Juliancolton/global.js&action=raw&ctype=text/javascript'); bpw2xvtfjtf62b9deio5bl6atijiev1 Geloofsbelydenis van die Ou Apostoliese Kerk 0 2043 7353 7349 2023-12-07T05:13:29Z 94rain 2008 Wysigings deur [[Special:Contributions/Андрейкабах|Андрейкабах]] teruggerol na laaste weergawe deur [[User:Nadzik|Nadzik]] 6851 wikitext text/x-wiki Die huidige '''Geloofsbelydenis van die Ou Apostoliese Kerk'''. Die Ou Apostoliese Kerk is een van die kerke wat ontstaan het uit die Katoliek Apostoliese Kerk en later die Nuwe Apostoliese Kerk uit. Dit is deel van 'n groep kerke wat bekend staan as Apostoliese Kerke, of Irvingisme. ==Skakels== {{wikipedia| Ou Apostoliese Kerk}} lvvqymybclpupsqu7zywz7odfs2lwu9 Gebruiker:Mercy 2 2044 4119 3755 2010-08-05T13:09:55Z Mercy 329 Het [[Gebruiker:Mercy]] beskerm: vandalism prevention ([edit=autoconfirmed] (verval nie) [move=autoconfirmed] (verval nie)) 4119 wikitext text/x-wiki [[meta:user:Mercy]] qs5j55ls1svle11xqayad9ozm2xr394 Gebruiker:Sj 2 2045 3756 2009-05-28T00:06:20Z Sj 359 m 3756 wikitext text/x-wiki [[m:User:Sj|SJ]] Klein from the MetaWiki. 8755rvcuy3fjznt95sqt91h2xtve7in Gebruiker:Lukas9950 2 2046 3769 3757 2009-09-10T20:56:41Z Lukas9950 306 3769 wikitext text/x-wiki de<br> en-1<br> af-0 __NOINDEX__ 9i7327l33mzc6r3ue5y4jjkpcdn001v Gebruiker:SUL 2 2047 3760 2009-06-11T15:11:15Z SUL 349 Meta 3760 wikitext text/x-wiki [[m:User:SUL]] hq5qujqzwh2iei7lrsn3at2u1wghb5j Sjabloon:Softredirect 10 2048 5171 5168 2015-10-22T21:42:18Z Gangleri 13 improuved to [[:{{{1}}}|{{{2|{{{1}}}}}}]] using [[m:Soft redirect]]|soft redirect improuved to [[:{{{1}}}|{{{2|{{{1}}}}}}]] using [[m:Soft redirect]]|soft redirect - added BiDi safety - LANG="en" dir="ltr" 5171 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT ]]<span class="redirectText" id="softredirect">[[:{{{1}}}|{{{2|{{{1}}}}}}]]</span><br /><span style="font-size:85%; padding-left:52px;" LANG="en" dir="ltr" >This page is a [[m:Soft redirect|soft redirect]].</span> 1ck76o1bo02hg51p6ohu2xow0xkifnl Gebruiker:Emijrp 2 2049 3762 2009-06-26T18:35:48Z Emijrp 264 {{Softredirect|w:es:User:Emijrp}} 3762 wikitext text/x-wiki {{Softredirect|w:es:User:Emijrp}} htl6hidrekuj4ax21ky2e2seisrkzoa Gebruikerbespreking:Emijrp 3 2050 3763 2009-06-26T18:35:53Z Emijrp 264 {{Softredirect|w:es:User:Emijrp}} 3763 wikitext text/x-wiki {{Softredirect|w:es:User:Emijrp}} htl6hidrekuj4ax21ky2e2seisrkzoa Gebruiker:Rift~afwikibooks 2 2051 5033 3764 2015-04-16T16:06:28Z Maintenance script 1562 Maintenance script het bladsy [[Gebruiker:Rift]] na [[Gebruiker:Rift~afwikibooks]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Rift|Rift]]" to "[[Special:CentralAuth/Rift~afwikibo... 5033 wikitext text/x-wiki [[Image:Mind-the-gap.jpg|800px|center]] [[sv:Anv%C3%A4ndare:Rift]] jbp9h8rw1u1ogl0t3kvouh1wcry7l50 Gebruiker:Bff 2 2052 3829 3765 2010-01-02T01:50:11Z Bff 368 3829 wikitext text/x-wiki <br /><br /><br /><br /><br /><br /><br /><br /><br /><br /> {| align=right style="background-color:#BBC983; line-height:90%; border-style:ridge; border-width:3px; border-color:#BBC983;" |- || <div align=right style="font-size:12px; color:#271836"> NUMBEROFPAGES = '''{{NUMBEROFPAGES}}'''<br /> NUMBEROFARTICLES = '''{{NUMBEROFARTICLES}}'''<br /> NUMBEROFFILES = {{NUMBEROFFILES}}<br /> NUMBEROFEDITS = '''{{NUMBEROFEDITS}}'''<br /> NUMBEROFVIEWS = {{NUMBEROFVIEWS}}<br /> NUMBEROFUSERS = {{NUMBEROFUSERS}}<br /> NUMBEROFACTIVEUSERS = '''{{NUMBEROFACTIVEUSERS}}'''<br /> NUMBERINGROUP:bot = {{NUMBERINGROUP:bot}}<br /> NUMBERINGROUP:sysop = '''{{NUMBERINGROUP:sysop}}'''<br /> NUMBERINGROUP:bureaucrat = '''{{NUMBERINGROUP:bureaucrat}}'''<br /> [[Special:Listadmins|Listadmins]]</div> |} 8o1y21h9ye2vbkrktl63h7ktindgbvw Gebruiker:Nagy 2 2053 3767 2009-09-01T19:14:01Z Pathoschild 29 global user page ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3767 wikitext text/x-wiki <center><span class="plainlinks">[[m:User:Nagy|Nagy]] ([[m:User talk:Nagy|Discussion]] &bull; [[Special:Contributions/Nagy|Contributions]])</span></center> jm13tp2yyyvjs4r49fzf8ozinhvuqym Gebruiker:Beany/monobook.js 2 2055 6787 3771 2021-02-04T23:26:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6787 javascript text/javascript mw.loader.load('https://en.wikipedia.org/w/index.php?title=User:Beany/global.js&action=raw&ctype=text/javascript'); fed6kskn3lr333dbcg4lli2v9q1mg74 Gebruiker:Kved/monobook.js 2 2056 6804 3772 2021-02-04T23:29:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6804 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Kved/global.js&action=raw&ctype=text/javascript'); 4o67ggi2vtz3abh8jpin7db9v2rpd8k Gebruiker:Anonymous Dissident 2 2058 3774 2009-09-13T04:19:40Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/SynchCrosswiki|requested]]) 3774 wikitext text/x-wiki [[m:User:Anonymous Dissident|Meta]] | [[m:User:Anonymous Dissident/Matrix|Matrix]]<br /> ---- '''Anonymous Dissident''' (''none'') — [[Special:Contributions/Anonymous Dissident|edits]], [[User talk:Anonymous Dissident|talk]], [[Special:PrefixIndex/User:Anonymous_Dissident/|subpages]] ---- {{#time: H:i:s, j F Y }}.<br /> {{NUMBEROFARTICLES}} content pages.<br /> {{NUMBEROFUSERS}} users.<br /> {{NUMBEROFEDITS}} edits. ---- 9ma7n2a5na8g0erjm7d07qf1itjb36g Gebruiker:NuclearWarfare 2 2059 3835 3775 2010-01-23T08:59:04Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested]]) 3835 wikitext text/x-wiki [[m:User:NuclearWarfare|NuclearWarfare]] ([[m:User talk:NuclearWarfare|Discussion]] &bull; [[Special:Contributions/NuclearWarfare|Contributions]]) 3pa82jpa6n434t871ba5fh45cb26b9g Gebruiker:Carsrac 2 2061 4409 4399 2012-02-05T18:21:46Z CarsracBot 180 r2.6.4) (robot Bygevoeg: az, be, bg, bn, bs, ca, cs, cv, el, eo, et, eu, fa, gl, he, hi, hr, hu, ia, id, ie, is, ja, ka, kk, ku, ky, la, lt, mg, mk, ml, mr, ms, ne, no, oc, ru, sa, si, sl, sq, sr, su, sv, ta, te, tg, uk, ur, uz, vi, zh-min-nan 4409 wikitext text/x-wiki Ik ben een hollandse medewerker met een [[user:CarsracBot|bot]] genaamd [[:nl:user:Carsrac|Carsrac]]bot. [[ang:User:Carsrac]] [[ar:مستخدم:Carsrac]] [[az:İstifadəçi:Carsrac]] [[be:Удзельнік:Carsrac]] [[bg:Потребител:Carsrac]] [[bn:ব্যবহারকারী:Carsrac]] [[bs:Korisnik:Carsrac]] [[ca:Usuari:Carsrac]] [[cs:Uživatel:Carsrac]] [[cv:Хутшăнакан:Carsrac]] [[cy:Defnyddiwr:Carsrac]] [[da:Bruger:Carsrac]] [[de:Benutzer:Carsrac]] [[el:Χρήστης:Carsrac]] [[en:User:Carsrac]] [[eo:Uzanto:Carsrac]] [[es:Usuario:Carsrac]] [[et:Kasutaja:Carsrac]] [[eu:Lankide:Carsrac]] [[fa:کاربر:Carsrac]] [[fr:Utilisateur:Carsrac]] [[fy:Meidogger:Carsrac]] [[gl:Usuario:Carsrac]] [[he:משתמש:Carsrac]] [[hi:सदस्य:Carsrac]] [[hr:Suradnik:Carsrac]] [[hu:Szerkesztő:Carsrac]] [[ia:Usator:Carsrac]] [[id:Pengguna:Carsrac]] [[ie:Usator:Carsrac]] [[is:Notandi:Carsrac]] [[it:Utente:Carsrac]] [[ja:利用者:Carsrac]] [[ka:მომხმარებელი:Carsrac]] [[kk:Қатысушы:Carsrac]] [[ko:사용자:Carsrac]] [[ku:Bikarhêner:Carsrac]] [[ky:User:Carsrac]] [[la:Usor:Carsrac]] [[li:Gebroeker:Carsrac]] [[lt:Naudotojas:Carsrac]] [[mg:Mpikambana:Carsrac]] [[mk:Корисник:Carsrac]] [[ml:ഉപയോക്താവ്:Carsrac]] [[mr:सदस्य:Carsrac]] [[ms:Pengguna:Carsrac]] [[ne:प्रयोगकर्ता:Carsrac]] [[nl:Gebruiker:Carsrac]] [[no:Bruker:Carsrac]] [[oc:Utilizaire:Carsrac]] [[pa:ਮੈਂਬਰ:Carsrac]] [[pl:Wikipedysta:Carsrac]] [[ro:Utilizator:Carsrac]] [[ru:Участник:Carsrac]] [[sa:योजकः:Carsrac]] [[si:පරිශීලක:Carsrac]] [[sl:Uporabnik:Carsrac]] [[sq:Përdoruesi:Carsrac]] [[sr:Корисник:Carsrac]] [[su:Pamaké:Carsrac]] [[sv:Användare:Carsrac]] [[ta:பயனர்:Carsrac]] [[te:వాడుకరి:Carsrac]] [[tg:Корбар:Carsrac]] [[th:ผู้ใช้:Carsrac]] [[tl:Tagagamit:Carsrac]] [[uk:Користувач:Carsrac]] [[ur:صارف:Carsrac]] [[uz:Foydalanuvchi:Carsrac]] [[vi:Thành viên:Carsrac]] [[vo:Geban:Carsrac]] [[zh:User:Carsrac]] [[zh-min-nan:User:Carsrac]] llny4p75isykcsgd9own26w6ppr6b4s Wikibooks:Gebruikersportaal 4 2062 7404 7399 2024-07-27T02:46:33Z MediaWiki message delivery 1367 /* Vote now to fill vacancies of the first U4C */ nuwe afdeling 7404 wikitext text/x-wiki * '''af:''' * '''en:''' Requests for the [[m:bot|bot]] flag should be made on this page. This wiki uses the [[m:bot policy|standard bot policy]], and allows [[m:bot policy#Global_bots|global bots]] and [[m:bot policy#Automatic_approval|automatic approval of certain types of bots]]. Other bots should apply below, and then [[m:Steward requests/Bot status|request access]] from a steward if there is no objection. ==Waar is almal== Ek het een ding agter gekom tewyl ek voor die rekenaar sit ek en my kinders (twee) moet saam weer skool gaan so doende kan ek as ouer ook iets nuut uit die lewe leer.En een voordeel in ons eie taal.Wees trots daarop n voorreg!! ==Waar is almal== Waar is almal hierde is een van die beste plekke op aarde .dit sal ons taal ,afrikaans,baie goed doen so kom mense Freakazo->''E-pos my asb. by Freakazo@bummer.co.za as jy nogsteeds belangstel om nuwe boeke te skep.'' ==Duits== Op het tuisblad staat lappen tekst in het duits. Nu kan ik dat wel lezen en vele met mij. Maar een vertaling van het duits naar het afrikaans is wel gewenst. Zo wel het zichtbare deel als het onzichtbare deel in de 'broncode'. [[Gebruiker:Carsrac|Carsrac]] 16:46, 23 Oktober 2009 (UTC) ==Bot policy== Hello. To facilitate [[m:steward|steward]] granting of bot access, I suggest implementing the [[m:Bot policy|standard bot policy]] on this wiki. In particular, this policy allows stewards to automatically flag known interlanguage linking bots (if this page says that is acceptable), which form the vast majority of such requests. The policy also enables [[m:Bot policy#Global_bots|global bots]] on this wiki (if this page says that is acceptable), which are trusted bots that will be given bot access on every wiki that allows global bots. This policy makes bot access requesting much easier for local users, operators, and stewards. To implement it we only need to create a redirect to this page from [[Project:Bot policy]], and add a line at the top noting that it is used here. Please read the text at [[m:Bot policy]] before commenting. If you object, please say so; I hope to implement in two weeks if there is no objection, since it is particularly written to streamline bot requests on wikis with little or no community interested in bot access requests. [[Gebruiker:Carsrac|Carsrac]] 07:36, 7 Oktober 2009 (UTC) : Implemented. —<small>[[m:User:Pathoschild|Pathoschild]] 14:36:42, 19 April 2010 (UTC)</small> == IMPORTANT: Admin activity review == Apologies for writing in English; if you can translate this notice to help other readers then please do so. A new policy regarding the removal of "advanced rights" (administrator, bureaucrat, etc) was recently adopted by [[:m:Requests for comment/Activity levels of advanced administrative rights holders|global community consensus]] (your community received a notice about the discussion). According to this policy, the [[:m:stewards|stewards]] are reviewing administrators' activity on smaller wikis. To the best of our knowledge, your wiki does not have a formal process for removing "advanced rights" from inactive accounts. This means that the stewards will take care of this according to the new [[:m:Admin activity review|admin activity review]] here. We have determined that the following users meet the inactivity criteria (no edits and no log actions for more than 2 years): #Adriaan90 (administrator) These users will receive a notification soon, asking them to start a community discussion if they want to retain some or all of their rights. If the users do not respond, then their advanced rights will be removed by the stewards. However, if you as a community would like to create your own activity review process superseding the global one, want to make another decision about these inactive rights holders, or already have a policy that we missed, then please notify the [[:m:Stewards' noticeboard|stewards on Meta-Wiki]] so that we know not to proceed with the rights review on your wiki. Thanks, [[Gebruiker:QuiteUnusual|QuiteUnusual]] ([[Gebruikerbespreking:QuiteUnusual|kontak]]) 12:19, 19 Augustus 2013 (UTC) == Global AbuseFilter == <div lang="en" dir="ltr" class="mw-content-ltr">Hello, [[mw:Special:MyLanguage/Extension:AbuseFilter|AbuseFilter]] is a MediaWiki extension used to detect likely abusive behavior patterns, like pattern vandalism and spam. In 2013, [[m:Special:Mylanguage/Global AbuseFilter|Global AbuseFilters]] were enabled on a limited set of wikis including Meta-Wiki, MediaWiki.org, Wikispecies and (in early 2014) all the "[https://noc.wikimedia.org/conf/highlight.php?file=small.dblist small wikis]". Recently, global abuse filters were enabled on "[https://noc.wikimedia.org/conf/highlight.php?file=medium.dblist medium sized wikis]" as well. These filters are currently managed by stewards on Meta-Wiki and have shown to be very effective in preventing mass spam attacks across Wikimedia projects. However, there is currently no policy on how the global AbuseFilters will be managed although there are proposals. There is an ongoing [[m:Requests for comment/Global AbuseFilter|request for comment]] on policy governing the use of the global AbuseFilters. In the meantime, specific wikis can opt out of using the global AbuseFilter. These wikis can simply add a request to [[m:Global AbuseFilter/Opt-out wikis|this list]] on Meta-Wiki. More details can be found on [[m:Special:Mylanguage/Global AbuseFilter/2014 announcement|this page]] at Meta-Wiki. If you have any questions, feel free to ask on [[m:Talk:Global AbuseFilter|m:Talk:Global AbuseFilter]]. Thanks, [[m:User:PiRSquared17|PiRSquared17]], [[m:User:Glaisher|Glaisher]]</div> — 17:36, 14 November 2014 (UTC) <!-- Message sent by User:Glaisher@metawiki using the list at http://meta.wikimedia.org/w/index.php?title=Global_AbuseFilter/2014_announcement_distribution_list&oldid=10495115 --> == Cookbook Week == Hello, I want to tell you that I've made a proposal for a Cookbook event [[meta:Wikibooks/Cookbooks week|on this Meta page]]. I would be happy to see your comment ! Regards [[Gebruiker:Archi38|Archi38]] ([[Gebruikerbespreking:Archi38|kontak]]) 18:21, 15 Mei 2016 (UTC) == Compact Language Links enabled in this wiki today == {{int:Please-translate}} <div lang="en" dir="ltr" class="mw-content-ltr"> [[File:Compact-language-links-list.png|thumb|Screenshot of Compact Language Links interlanguage list]] [[:mw:Universal_Language_Selector/Compact_Language_Links|Compact Language Links]] has been available as a beta-feature on all Wikimedia wikis since 2014. With compact language links enabled, users are shown a much shorter list of languages on the interlanguage link section of an article (see image). Based on several factors, this shorter list of languages is expected to be more relevant for them and valuable for finding similar content in a language known to them. More information about compact language links can be found in [[:mw:Universal_Language_Selector/Compact_Language_Links|the documentation]]. From today onwards, compact language links has been enabled as the default listing of interlanguage links on this wiki. Using the button at the bottom, you will be able to see a longer list of all the languages the article has been written in. The setting for this compact list can be changed by using the checkbox under ''User Preferences -> Appearance -> Languages'' The compact language links feature has been tested extensively by the Wikimedia Language team, which developed it. However, in case there are any problems or other feedback please let us know on the [[:mw:Talk:Universal_Language_Selector/Compact_Language_Links|project talk page]] or on this discussion thread. It is to be noted that on some wikis the presence of an existing older gadget that was used for a similar purpose may cause an interference for compact language list. We would like to bring this to the attention of the admins of this wiki. Full details are on [[phab:T131455|this phabricator ticket]] (in English). Due to the large scale enablement of this feature, we have had to use [[:m:Global_message_delivery|MassMessage]] for this announcement and as a result it is only written in English. We will really appreciate if this message can be translated for other users of this wiki. Thank you. On behalf of the Wikimedia Language team: [[:mw:User:Runab_WMF|Runa Bhattacharjee (WMF)]] ([[mw:User talk:Runab_WMF|talk]]) 07:04, 24 Junie 2016 (UTC) </div> <!-- Message sent by User:Runab WMF@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Global_message_delivery/Targets/ULS_Compact_Links/24_June&oldid=15720673 --> == Improved search in deleted pages archive == {{int:please-translate}} During Wikimedia Hackathon 2016, the [[mw:Wikimedia_Discovery|Discovery]] team [https://phabricator.wikimedia.org/T109561 worked] on one of the items on the 2015 community wishlist, namely [[m:2015_Community_Wishlist_Survey/Search#Provide_a_means_of_searching_for_deleted_pages|enabling searching the archive of deleted pages]]. This feature is now ready for production deployment, and will be enabled on all wikis, except Wikidata. Right now, the feature is behind a feature flag - to use it on your wiki, please go to the <code>Special:Undelete</code> page, and add <code>&fuzzy=1</code> to the URL, like this: https://test.wikipedia.org/w/index.php?title=Special%3AUndelete&fuzzy=1. Then search for the pages you're interested in. There should be more results than before, due to using ElasticSearch indexing (via the CirrusSearch extension). We plan to enable this improved search by default on all wikis soon (around August 1, 2017). If you have any objections to this - please raise them with the Discovery team via [http://mailto:discovery@lists.wikimedia.org email] or on this announcement's discussion page. Like most Mediawiki configuration parameters, the functionality can be configured per wiki. Once the improved search becomes the default, you can still access the old mode using <code>&fuzzy=0</code> in the URL, like this: https://test.wikipedia.org/w/index.php?title=Special%3AUndelete&fuzzy=0 Please note that since Special:Undelete is an admin-only feature, this search capability is also only accessible to wiki admins. {{Int:Feedback-thanks-title}} [[m:User:CKoerner (WMF)|CKoerner (WMF)]] ([[m:User talk:CKoerner (WMF)|talk]]) 18:40, 25 Julie 2017 (UTC) <!-- Message sent by User:CKoerner (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:CKoerner_(WMF)/Archive_search_announce/Distribution_list&oldid=17036927 --> == Update on page issues on mobile web == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> '''Update on page issues on mobile web''' {{int:please-translate}} Hi everyone. The [[mw:Reading/Web/Team|Readers web team]] has recently begun working on exposing issue templates on the mobile website. Currently, details about issues with page content are generally hidden on the mobile website. This leaves readers unaware of the reliability of the pages they are reading. The goal of this project is to improve awareness of particular issues within an article on the mobile web. We will do this by changing the visual styling of page issues. So far, we have [[mw:Reading/Web/Projects/Mobile Page Issues|drafted a proposal on the design and implementation]] of the project. We were also able to run [[mw:Reading/Web/Projects/Mobile Page Issues/Research Results|user testing on the proposed designs]]. The tests so far have positive results. Here is a quick summary of what we learned: * The new treatment increases awareness of page issues among participants. This is true particularly when they are in a more evaluative/critical mode. * Page issues make sense to readers and they understand how they work * Readers care about page issues and consider them important * Readers had overwhelmingly positive sentiments towards Wikipedia associated with learning about page issues Our next step would be to start implementing these changes. We wanted to reach out to you for any concerns, thoughts, and suggestions you might have before beginning development. Please [[mw:Reading/Web/Projects/Mobile Page Issues|visit the project page]] where we have more information and mockups of how this may look. Please [[mw:Talk:Reading/Web/Projects/Mobile Page Issues|leave feedback on the talk page]]. </div> [[m:User:CKoerner (WMF)|CKoerner (WMF)]] ([[m:User talk:CKoerner (WMF)|talk]]) 20:58, 12 Junie 2018 (UTC) <!-- Message sent by User:CKoerner (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:CKoerner_(WMF)/Sandbox&oldid=18120916 --> == Community Wishlist 2020 == [[File:Magic Wand Icon 229981 Color Flipped.svg|right|48px]] <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> The '''[[m:Special:MyLanguage/Community Wishlist Survey 2020|2020 Community Wishlist Survey]]''' is now open! This survey is the process where communities decide what the [[m:Community Tech|Community Tech]] team should work on over the next year. We encourage everyone to submit proposals until the deadline on '''November 11, 2019''', or comment on other proposals to help make them better. '''This year, we’re exclusively focusing on smaller projects (i.e., Wikibooks, Wiktionary, Wikiquote, Wikisource, Wikiversity, Wikispecies, Wikivoyage, and Wikinews).''' We want to help these projects and provide meaningful improvements to diverse communities. If you’re a member of any of these projects, please participate in the survey! To submit proposals, see the guidelines on the [[m:Special:MyLanguage/Community Wishlist Survey 2020#Guidelines|survey page]]. You can write proposals in any language, and we will translate them for you. Thank you, and we look forward to seeing your proposals! </div> [[:m:user:IFried (WMF)|IFried (WMF)]] 19:30, 4 November 2019 (UTC) <!-- Message sent by User:Trizek (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Trizek_(WMF)/sandbox/temp_MassMessage_list&oldid=19523495 --> == Wiki Loves Folklore == [[File:WLL Subtitled Logo (transparent).svg|100px|right|frameless]] '''Hello Folks,''' Wiki Loves Love is back again in 2020 iteration as '''[[:c:Commons:Wiki Loves Folklore|Wiki Loves Folklore]]''' from 1 February, 2020 - 29 February, 2020. Join us to celebrate the local cultural heritage of your region with the theme of folklore in the international photography contest at [https://commons.wikimedia.org/w/index.php?title=Special:UploadWizard&campaign=wllove Wikimedia Commons]. Images, videos and audios representing different forms of folk cultures and new forms of heritage that haven’t otherwise been documented so far are welcome submissions in Wiki Loves Folklore. Learn more about the contest at [[m:Wiki Loves Folklore|Meta-Wiki]] and [[:c:Commons:Wiki Loves Folklore|Commons]]. '''Kind regards,'''<br/> [[:c:Commons:Wiki Loves Folklore/International Team|'''Wiki Loves Folklore International Team''']]<br/> <small>&mdash;&nbsp;[[User:Tulsi Bhagat|<font color="black">'''Tulsi Bhagat'''</font>]] <small>([[Special:Contributions/Tulsi Bhagat|<font color="black">contribs</font>]] &#124; [[User talk:Tulsi Bhagat|<font color="black">talk</font>]])</small><br/> sent using [[Gebruiker:MediaWiki message delivery|MediaWiki message delivery]] ([[Gebruikerbespreking:MediaWiki message delivery|kontak]]) 06:14, 18 Januarie 2020 (UTC)</small> <!-- Message sent by User:Tulsi Bhagat@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Tiven2240/wll&oldid=19716850 --> == Global bot policy proposal: invitation to a Meta discussion == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> {{int:hello}}! I apologize for sending a message in English. {{int:please-translate}}. According to [[:m:Bot_policy/Implementation#Where_it_is_policy|the list]], your wiki project currently is opted in to the [[:m:Bot_policy#Global_bots|global bot policy]]. Under this policy, bots that fix double redirects or maintain interwiki links are allowed to operate under a global bot flag that is assigned directly by the stewards. As the Wikimedia projects developed, the need for the current global bot policy decreased, and in the past years, no bots were appointed via that policy. That is mainly given Wikidata were estabilished in 2013, and it is no longer necessary to have dozens of bots that maintain interwiki links. A [[:m:Requests for comment/Refine global bot policy|proposal]] was made at Meta-Wiki, which proposes that the stewards will be authorized to determine whether an uncontroversial task may be assigned a global bot flag. The stewards already assign permissions that are more impactful on many wikis, namely, [[:m:GS|global sysops]] and [[:m:GR|global renamers]], and I do not think that trust should be an issue. The stewards will assign the permission only to time-proven bots that are already approved at a number of projects, like [[:m:User:ListeriaBot|ListeriaBot]]. By this message, I would like to invite you to comment [[:m:Requests for comment/Refine global bot policy|in the global RFC]], to voice your opinion about this matter. Thank you for your time. Best regards,<br /> [[User:Martin Urbanec|Martin Urbanec]] ([[:m:User talk:Martin Urbanec|{{int:Talkpagelinktext}}]]) 11:49, 24 November 2020 (UTC) </div> <!-- Message sent by User:Martin Urbanec@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Martin_Urbanec/sand&oldid=20709229 --> == Universal Code of Conduct enforcement consultations == Dear all, you may know me under my Wikimedia username – [[w:User:Nadzik|Nadzik]]. I came here last year to contribute to your project as well as I can. I am sorry for writing to you in English, but this will make the message more understandable, than using an automatic translator. Feel free to translate my post! Over the next few weeks, [[w:Wikimedia Foundation|Wikimedia Foundation]] will be consulting on the implementation and the enforcement of the [[:meta:Universal Code of Conduct/Draft review/en|Universal Code of Conduct]], which will constitute an appendix to the currently applicable [https://foundation.wikimedia.org/wiki/Terms_of_Use/en Terms of Use]. === What is the Universal Code of Conduct? === The UCoC is intended to serve as a document that will incorporate the basic standards of behaviour in order to standardize them across all Wikimedia projects. It aims to include a list of inappropriate behaviours that will not be accepted in our projects, and also takes care of the safety of all users. It is also intended to provide a common ground in those communities that do not have their own specific regulations and rules on this subject. It will widely help smaller and younger projects that have not yet had the opportunity to write down their own rules related to the inappropriate behaviour of their contributors. [[:m:Universal Code of Conduct/Initial 2020 Consultations|Consultations carried out in 2019 and in the first half of 2020]] allowed for the preparation of a preliminary proposal of rules, however, there are still no provisions related to the implementation of the UCoC. To this end consultations started in many Wikimedia project communities. === How will the consultations work? === In January and February 2021, nine language facilitators from the Wikimedia Foundation will engage in a series of consultations with different language communities (including Wikidata and Commons user communities). I've also asked to be allowed consulting with the Afrikaans community, as I've had the pleasure to work with some of you before. In the coming weeks, we will have the opportunity to talk together about your views, visions and ideas for implementation in connection with the introduction of UCoC . The goal of the Wikimedia Foundation is to obtain information from various communities, and only on the basis of the currently conducted consultations, our team will prepare and present reports and various possibilities of implementing UCoC into force. I encourage everyone to share their opinion with me and with other members of our community. Starting in February, some of you may also be contacted by a dedicated affiliate outreach or user group outreach. === How to participate? === Feel free to express your opinion in the most convenient way for you. To enable everyone willing to participate in consultations, they will be conducted in several ways: # Village pump discussion at [[w:Wikipedia:Geselshoekie#Universal Code of Conduct enforcement consultations|af.wikipedia]] # Opening a new thread on my [[w:User talk:MNadzikiewicz (WMF)|User talk page]] # Emailing me [[Spesiaal:Stuur_e-pos/MNadzikiewicz_(WMF)|directly via Wikimail]] Additionally, in the coming days, an anonymous poll will be launched for community members who would like to privately convey their feelings about the UCoC, as well as the spheres surrounding it (the state of the rules in our projects, unwanted situations and other developments you are willing to discuss). I also invite you to visit [[:meta:Universal Code of Conduct/FAQ|FAQ-page]], that already has answers to most frequently asked questions. If you have any questions, ping me, to make sure that I see your message! I wish us all a fruitful debate! [[Gebruiker:MNadzikiewicz (WMF)|MNadzikiewicz (WMF)]] ([[Gebruikerbespreking:MNadzikiewicz (WMF)|kontak]]) 09:50, 20 Januarie 2021 (UTC) == Wiki Loves Folklore 2021 is back! == <div lang="en" dir="ltr" class="mw-content-ltr"> {{int:please-translate}} [[File:Wiki Loves Folklore Logo.svg|right|150px|frameless]] You are humbly invited to participate in the '''[[:c:Commons:Wiki Loves Folklore 2021|Wiki Loves Folklore 2021]]''' an international photography contest organized on Wikimedia Commons to document folklore and intangible cultural heritage from different regions, including, folk creative activities and many more. It is held every year from the 1st till the 28th of February. You can help in enriching the folklore documentation on Commons from your region by taking photos, audios, videos, and [https://commons.wikimedia.org/w/index.php?title=Special:UploadWizard&campaign=wlf_2021 submitting] them in this commons contest. Please support us in translating the [[:c:Commons: Wiki Loves Folklore 2021|project page]] and a [https://meta.wikimedia.org/wiki/Special:Translate?group=Centralnotice-tgroup-wikiloveslove2020&language=en&filter=%21translated&action=translate|one-line banner message] to help us spread the word in your native language. '''Kind regards,''' '''Wiki loves Folklore International Team''' [[Gebruiker:MediaWiki message delivery|MediaWiki message delivery]] ([[Gebruikerbespreking:MediaWiki message delivery|kontak]]) 13:25, 6 Februarie 2021 (UTC) </div> <!-- Message sent by User:Tiven2240@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Tiven2240/wll&oldid=21073884 --> == Proposal: Set two-letter project shortcuts as alias to project namespace globally == <div lang="en" dir="ltr"> {{int:please-translate}} Hello everyone, I apologize for posting in English. I would like to inform everyone that I created a new global request for comment (GRFC) at Meta Wiki, which may affect your project: [[:m:Requests for comment/Set short project namespace aliases by default globally]]. In this GRFC, I propose that two-project shortcuts for project names will become a default alias for the project namespace. For instance, on all Wikipedias, WP will be an alias to the Wikipedia: namespace (and similar for other projects). Full list is available in the GRFC. This is already the case for Wikivoyages, and many individual projects asked for this alias to be implemented. I believe this makes it easier to access the materials in the project namespace, as well as creating shortcuts like <tt>WP:NPOV</tt>, as well as helps new projects to use this feature, without having to figure out how to request site configuration changes first. As far as I can see, {{SITENAME}} currently does not have such an alias set. This means that such an alias will be set for you, if the GRFC is accepted by the global community. I would like to ask all community members to participate in the request for comment at Meta-Wiki, see [[:m:Requests for comment/Set short project namespace aliases by default globally]]. Please feel free to [[:m:User talk:Martin Urbanec|ask me]] if you have any questions about this proposal. Best regards,<br /> --[[:m:User:Martin Urbanec|Martin Urbanec]] ([[:m:User talk:Martin Urbanec|talk]]) 14:11, 18 Februarie 2021 (UTC) </div> <!-- Message sent by User:Martin Urbanec@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Martin_Urbanec/MassMessage&oldid=21125035 --> == Global bot policy changes == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> {{int:hello}}! I apologize for sending a message in English. {{int:please-translate}}. According to [[:m:Bot_policy/Implementation#Where_it_is_policy|the list]], your wiki project is currently opted in to the [[:m:Bot_policy#Global_bots|global bot policy]]. As such, I want to let you know about some changes that were made after the [[:m:Requests for comment/Refine global bot policy|global RfC]] was closed. *Global bots are now subject to a 2 week discussion, and it'll be publicized via a MassMessage list, available at [[:m:Bot policy/New global bot discussion|Bot policy/New global bot discussion]] on Meta. Please subscribe yourself or your wiki if you are interested in new global bots proposals. *For a bot to be considered for approval, it must demonstrate it is welcomed in multiple projects, and a good way to do that is to have the bot flag on at least 5 wikis for a single task. *The bot operator should make sure to adhere to the wiki's preference as related to the use of the bot flag (i.e., if a wiki doesn't want a bot to use the flag as it edits, that should be followed). Thank you for your time. Best regards,<br /> —'''''<span style="font-family:Candara">[[User:Tks4Fish|<span style="color:black">Thanks for the fish!</span>]] <sup>[[User Talk:Tks4Fish|<span style="color:blue">talk</span>]]•[[Special:Contribs/Tks4Fish|contribs]]</sup></span>''''' 18:48, 6 April 2021 (UTC) </div> <!-- Message sent by User:Tks4Fish@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Tks4Fish/temp&oldid=21306363 --> == Universal Code of Conduct - Enforcement draft guidelines review == The [[:meta:Universal_Code_of_Conduct/Drafting_committee#Phase_2|Universal Code of Conduct Phase 2 drafting committee]] would like comments about the [[:meta:Universal_Code_of_Conduct/Enforcement_draft_guidelines_review|enforcement draft guidelines]] for the [[:meta:Universal_Code_of_Conduct|Universal Code of Conduct]] (UCoC). This review period is planned for 17 August 2021 through 17 October 2021. These guidelines are not final but you can help move the progress forward. The committee will revise the guidelines based upon community input. Comments can be shared in any language on the [[:meta:Universal_Code_of_Conduct/Enforcement_draft_guidelines_review|draft review talk page]] and [[:meta:Universal_Code_of_Conduct/Discussions|multiple other venues]]. Community members are encouraged to organize conversations in their communities. There are planned live discussions about the UCoC enforcement draft guidelines: [[:Wikimania:2021:Submissions/Universal_Code_of_Conduct_Roundtable|Wikimania 2021 session]] - 16 August @ 11:00 UTC - 11:45 UTC [[:meta:Universal_Code_of_Conduct/2021_consultations/Roundtable_discussions#Conversation_hours|Conversation hours]] - 24 August, 31 August, 7 September @ 03:00 UTC & 14:00 UTC [[:meta:Universal_Code_of_Conduct/2021_consultations/Roundtable_discussions|Roundtable calls]] - 18 September @ 03:00 UTC & 15:00 UTC Summaries of discussions will be posted every two weeks [[:meta:Universal_Code_of_Conduct/Drafting_committee/Digests|here]]. Please let me know if you have any questions. Best,[[Gebruiker:Zuz (WMF)|Zuz (WMF)]] ([[Gebruikerbespreking:Zuz (WMF)|kontak]]) 11:10, 23 Augustus 2021 (UTC) == Wiki Loves Folklore is back! == <div lang="en" dir="ltr" class="mw-content-ltr"> {{int:please-translate}} [[File:Wiki Loves Folklore Logo.svg|right|150px|frameless]] You are humbly invited to participate in the '''[[:c:Commons:Wiki Loves Folklore 2022|Wiki Loves Folklore 2022]]''' an international photography contest organized on Wikimedia Commons to document folklore and intangible cultural heritage from different regions, including, folk creative activities and many more. It is held every year from the '''1st till the 28th''' of February. You can help in enriching the folklore documentation on Commons from your region by taking photos, audios, videos, and [https://commons.wikimedia.org/w/index.php?title=Special:UploadWizard&campaign=wlf_2022 submitting] them in this commons contest. You can also [[:c:Commons:Wiki Loves Folklore 2022/Organize|organize a local contest]] in your country and support us in translating the [[:c:Commons:Wiki Loves Folklore 2022/Translations|project pages]] to help us spread the word in your native language. Feel free to contact us on our [[:c:Commons talk:Wiki Loves Folklore 2022|project Talk page]] if you need any assistance. '''Kind regards,''' '''Wiki loves Folklore International Team''' --[[Gebruiker:MediaWiki message delivery|MediaWiki message delivery]] ([[Gebruikerbespreking:MediaWiki message delivery|kontak]]) 13:14, 9 Januarie 2022 (UTC) </div> <!-- Message sent by User:Tiven2240@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Tiven2240/wlf&oldid=22560402 --> == Subscribe to the This Month in Education newsletter - learn from others and share your stories == <div lang="en" dir="ltr" class="mw-content-ltr"> Dear community members, Greetings from the EWOC Newsletter team and the education team at Wikimedia Foundation. We are very excited to share that we on tenth years of Education Newsletter ([[m:Education/News|This Month in Education]]) invite you to join us by [[m:Global message delivery/Targets/This Month in Education|subscribing to the newsletter on your talk page]] or by [[m:Education/News/Newsroom|sharing your activities in the upcoming newsletters]]. The Wikimedia Education newsletter is a monthly newsletter that collects articles written by community members using Wikimedia projects in education around the world, and it is published by the EWOC Newsletter team in collaboration with the Education team. These stories can bring you new ideas to try, valuable insights about the success and challenges of our community members in running education programs in their context. If your affiliate/language project is developing its own education initiatives, please remember to take advantage of this newsletter to publish your stories with the wider movement that shares your passion for education. You can submit newsletter articles in your own language or submit bilingual articles for the education newsletter. For the month of January the deadline to submit articles is on the 20th January. We look forward to reading your stories. Older versions of this newsletter can be found in the [[outreach:Education/Newsletter/Archives|complete archive]]. More information about the newsletter can be found at [[m:Education/News/Publication Guidelines|Education/Newsletter/About]]. For more information, please contact spatnaik{{@}}wikimedia.org. ------ <div style="text-align: center;"><div style="margin-top:10px; font-size:90%; padding-left:5px; font-family:Georgia, Palatino, Palatino Linotype, Times, Times New Roman, serif;">[[m:Education/Newsletter/About|About ''This Month in Education'']] · [[m:Global message delivery/Targets/This Month in Education|Subscribe/Unsubscribe]] · [[m:MassMessage|Global message delivery]] · For the team: [[User:ZI Jony|<span style="color:#8B0000">'''ZI Jony'''</span>]] [[User talk:ZI Jony|<sup><span style="color:Green"><i>(Talk)</i></span></sup>]], {{<includeonly>subst:</includeonly>#time:l G:i, d F Y|}} (UTC)</div></div> </div> <!-- Message sent by User:ZI Jony@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:ZI_Jony/MassMessage/Awareness_of_Education_Newsletter/List_of_Village_Pumps&oldid=21244129 --> == The Vector 2022 skin as the default in two weeks? == <div lang="en" dir="ltr" class="mw-content-ltr"> [[File:Wikimania 2022 Vector (2022) Presentation.pdf|thumb|The slides for our presentation at Wikimania 2022|page=26]] Hello. I'm writing on behalf of the [[mw:Reading/Web|Wikimedia Foundation Web team]]. '''In two weeks, we would like to make the Vector 2022 skin the default on this wiki.''' We have been working on it for the past three years. So far, it has been the default on more than 30 wikis, including sister projects, all accounting for more than 1 billion pageviews per month. On average [[phab:T317529#8246686|87% of active logged-in users]] of those wikis use Vector 2022. It would become the default for all logged-out users, and also all logged-in users who currently use Vector legacy. Logged-in users can at any time switch to [[Special:Preferences#mw-prefsection-rendering|any other skins]]. No changes are expected for users of these skins. <div style="width:100%; margin:auto;"><gallery widths="220" heights="150" mode="packed" caption="Top of an article"> Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2010 top.png|Vector legacy (current default) Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2022 top.png|Vector 2022 </gallery><gallery widths="220" heights="150" mode="packed" caption="A section of an article"> Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2010 scrolled.png|Vector legacy (current default) Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2022 scrolled.png|Vector 2022 </gallery></div> === About the skin === '''[Why is a change necessary]''' The current default skin meets the needs of the readers and editors as these were 13 years ago. Since then, new users have begun using Wikimedia projects. [https://diff.wikimedia.org/2022/08/18/prioritizing-equity-within-wikipedias-new-desktop/ The old Vector doesn't meet their needs.] '''[Objective]''' The objective for the new skin is to make the interface more welcoming and comfortable for readers and useful for advanced users. It draws inspiration from previous requests, the [[metawiki:Special:MyLanguage/Community_Wishlist_Survey|Community Wishlist Surveys]], and gadgets and scripts. The work helped our code follow the standards and improve all other skins. [[phab:phame/post/view/290/how_and_why_we_moved_our_skins_to_mustache/|We reduced PHP code in Wikimedia deployed skins by 75%]]. The project has also focused on making it easier to support gadgets and use APIs. '''[Changes and test results]''' The skin introduces a [[mw:Special:MyLanguage/Reading/Web/Desktop Improvements/Features|series of changes]] that improve readability and usability. The new skin does not remove any functionality currently available on the Vector skin. * The sticky header makes it easier to find tools that editors use often. It decreases scrolling to the top of the page by 16%. * The new table of contents makes it easier to navigate to different sections. Readers and editors jumped to different sections of the page 50% more than with the old table of contents. It also looks a bit different on talk pages. * The new search bar is easier to find and makes it easier to find the correct search result from the list. This increased the amount of searches started by 30% on the wikis we tested on. * The skin does not negatively affect pageviews, edit rates, or account creation. There is evidence of increases in pageviews and account creation across partner communities. '''[Try it out]''' Try out the new skin by going to the appearance tab in [[Special:Preferences#mw-prefsection-rendering|your preferences]] and selecting Vector 2022 from the list of skins. === How can editors change and customize this skin? === It's possible to configure and personalize our changes. We support volunteers who create new gadgets and user scripts. Check out [[mw:Special:MyLanguage/Reading/Web/Desktop Improvements/Repository|our repository]] for a list of currently available customizations, or add your own. === Our plan === '''If no large concerns are raised, we plan on deploying in the week of October 3, 2022'''. If your community would like to request more time to discuss the changes, hit the button and write to us. We can adjust the calendar. <div style="text-align: center;">[[mw:Talk:Reading/Web/Desktop Improvements|<span class="plainlinks mw-ui-button">Request for more time to discuss the change</span>]]</div> If you'd like ask our team anything, if you have questions, concerns, or additional thoughts, please ping me here or write on the [[mw:Talk:Reading/Web/Desktop Improvements|talk page of the project]]. We will gladly answer! Also, [[mw:Reading/Web/Desktop Improvements/Frequently asked questions|see our FAQ]]. Thank you! [[mw:User:SGrabarczuk (WMF)|SGrabarczuk (WMF)]] ([[mw:User talk:SGrabarczuk (WMF)|talk]]) 04:14, 22 September 2022 (UTC) </div> <!-- Message sent by User:SGrabarczuk (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:SGrabarczuk_(WMF)/sandbox/MM/Varia&oldid=23838600 --> == Community Wishlist Survey 2023 opens in January == <div lang="en" dir="ltr" class="mw-content-ltr"> ''{{int:Please-translate}}'' (There is [[m:Community Wishlist Survey 2023 opens in January|a translatable version of this message on MetaWiki]]) {{int:Hello}} The [[m:Community Wishlist Survey 2023|'''Community Wishlist Survey (CWS) 2023''']], which lets contributors propose and vote for tools and improvements, starts next month on Monday, [https://zonestamp.toolforge.org/1674496831 23 January 2023, at 18:00 UTC] and will continue annually. We are inviting you to share your ideas for technical improvements to our tools and platforms. Long experience in editing or technical skills is not required. If you have ever used our software and thought of an idea to improve it, this is the place to come share those ideas! The dates for the phases of the Survey will be as follows: * Phase 1: Submit, discuss, and revise proposals – Monday, Jan 23, 2023 to Sunday, Feb 6, 2023 * Phase 2: WMF/Community Tech reviews and organizes proposals – Monday, Jan 30, 2023 to Friday, Feb 10, 2023 * Phase 3: Vote on proposals – Friday, Feb 10, 2023 to Friday, Feb 24, 2023 * Phase 4: Results posted – Tuesday, Feb 28, 2023 If you want to start writing out your ideas ahead of the Survey, you can start thinking about your proposals and draft them in [[m:Community Wishlist Survey/Sandbox|the CWS sandbox]]. We are grateful to all who participated last year. See you in January 2023! </div> {{int:Feedback-thanks-title}} <bdi lang="en" dir="ltr">Community Tech, [[m:User:STei (WMF)|STei (WMF)]]</bdi> 16:44, 15 Desember 2022 (UTC) <!-- Message sent by User:Sannita (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Community_Wishlist_list_for_non-Wikipedias&oldid=24239678 --> == Global ban for PlanespotterA320/RespectCE == Per the [[m:Global bans|Global bans]] policy, I'm informing the project of this request for comment: [[m:Requests for comment/Global ban for PlanespotterA320 (2) ]] about banning a member from your community. Thank you.--[[User:Lemonaka|Lemonaka]] ([[User talk:Lemonaka|talk]]) 21:40, 6 February 2023 (UTC) <!-- Message sent by User:Zabe@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Lemonaka/Massmessagelist&oldid=24501599 --> == Your wiki will be in read only soon == <section begin="server-switch"/><div class="plainlinks"> [[:m:Special:MyLanguage/Tech/Server switch|Lees hierdie boodskap in 'n ander taal]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-Tech%2FServer+switch&language=&action=page&filter= {{int:please-translate}}] Die [[foundation:|Wikimedia Foundation]] toets sy sekondêre datasentrum. Dit sal verseker dat Wikipedia en die ander Wikimedia wiki's aanlyn kan bly, selfs ná 'n ramp. Om seker te maak dat alles werk, moet die afdeling Wikimedia Technology 'n beplande toets aflê. Hierdie toets sal wys of hulle betroubaar van die een datasentrum na die ander kan oorskakel. Dit verg baie spanne om voor te berei vir die toets en beskikbaar te wees om enige onverwagte probleme op te los. <span class="mw-translate-fuzzy">Hulle sal alle verkeer na die sekondêre datacenter op '''{{#time:j xg|2023-03-01|af}}''' oorskakel.</span> Die toets begin om '''[https://zonestamp.toolforge.org/{{#time:U|2023-03-01T14:00|en}} {{#time:H:i e|2023-03-01T14:00}}]''' (15:00 BST, 16:00 CEST, 10:00 EDT, 19:30 IST, 07:00 PDT, 23:00 JST, en in Nieu-Seeland om 02:00 NZST op $date). Ongelukkig, as gevolg van 'n paar beperkings in [[mw:Manual:What is MediaWiki? | MediaWiki]], alle redigering moet stop terwyl ons oorskakel. Ons vra om verskoning vir hierdie ontwrigting en werk daarna om dit in die toekoms tot die minimum te beperk. '''U sal alle wiki's vir 'n kort tydjie kan lees, maar nie kan redigeer nie.''' *U kan {{#time:l j xg Y|2023-03-01|af}} nie tot 'n uur lank wysig nie. *As u gedurende hierdie tye probeer redigeer of stoor, sal u 'n foutboodskap sien. Ons hoop dat geen wysigings verlore sal gaan gedurende hierdie minute nie, maar ons kan dit nie waarborg nie. As u die foutboodskap sien, wag dan totdat alles weer normaal is. Dan moet u u redigering kan stoor. Maar ons beveel aan dat u eers 'n afskrif van u wysigings maak, net vir ingeval. ''Ander effekte'': *Agtergrondgeleenthede sal stadiger wees en sommige sal moontlik afgeneem word. Rooi skakels word moontlik nie so vinnig soos gewoonlik opgedateer nie. As u 'n artikel skep wat reeds elders gekoppel is, sal die skakel langer as gewoonlik rooi bly. Sommige skrifte met 'n lang hardloop moet gestop word. * <span lang="en" dir="ltr" class="mw-content-ltr">We expect the code deployments to happen as any other week.</span> <span lang="en" dir="ltr" class="mw-content-ltr">However, some case-by-case code freezes could punctually happen if the operation require them afterwards.</span> * <span lang="en" dir="ltr" class="mw-content-ltr">[[mw:Special:MyLanguage/GitLab|GitLab]] will be unavailable for about 90 minutes.</span> Hierdie projek kan indien nodig uitgestel word. Jy kan [[wikitech:Switch_Datacenter|die skedule lees by wikitech.wikimedia.org]]. Enige veranderinge sal in die skedule aangekondig word. Daar sal meer kennisgewings hieroor wees. <span lang="en" dir="ltr" class="mw-content-ltr">A banner will be displayed on all wikis 30 minutes before this operation happens.</span> '''Deel asseblief hierdie inligting met u gemeenskap.'''</div><section end="server-switch"/> <span dir=ltr>[[m:User:Trizek (WMF)|Trizek (WMF)]] ([[m:User talk:Trizek (WMF)|{{int:talk}}]])</span> 21:20, 27 Februarie 2023 (UTC) <!-- Message sent by User:Trizek (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=24390465 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Wikimania 2023 Welcoming Program Submissions</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="wikimania-program-submissions"/>[[File:Wikimania Singapore Logo.svg|right|frameless]]Do you want to host an in-person or virtual session at Wikimania 2023? Maybe a hands-on workshop, a lively discussion, a fun performance, a catchy poster, or a memorable lightning talk? [[wmania:Special:MyLanguage/2023:Program/Submissions|'''Submissions are open until March 28''']]. The event will have dedicated hybrid blocks, so virtual submissions and pre-recorded content are also welcome. If you have any questions, please join us at an upcoming conversation on March 12 or 19, or reach out by email at wikimania@wikimedia.org or on Telegram. More information on-wiki.<section end="wikimania-program-submissions"/> </div> <!-- Message sent by User:CKoerner (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=24390465 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Seeking volunteers for the next step in the Universal Code of Conduct process</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''<div class="plainlinks">[[m:Special:MyLanguage/Universal Code of Conduct/U4C Building Committee/Nominations/Announcement|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/U4C Building Committee/Nominations/Announcement}}&language=&action=page&filter= {{int:please-translate}}]</div>'' Hello, As follow-up to [https://lists.wikimedia.org/hyperkitty/list/wikimedia-l@lists.wikimedia.org/message/IOMVS7W75ZYMABQGOQ2QH2JAURC3CHGH/ the message about the Universal Code of Conduct Enforcement Guidelines] by Wikimedia Foundation Board of Trustees Vice Chair, Shani Evenstein Sigalov, I am reaching out about the next steps. I want to bring your attention to the next stage of the Universal Code of Conduct process, which is forming a building committee for the Universal Code of Conduct Coordinating Committee (U4C). I invite community members with experience and deep interest in community health and governance to nominate themselves to be part of the U4C building committee, which needs people who are: * Community members in good standing * Knowledgeable about movement community processes, such as, but not limited to, policy drafting, participatory decision making, and application of existing rules and policies on Wikimedia projects * Aware and appreciative of the diversity of the movement, such as, but not limited to, languages spoken, identity, geography, and project type * Committed to participate for the entire U4C Building Committee period from mid-May - December 2023 * Comfortable with engaging in difficult, but productive conversations * Confidently able to communicate in English The Building Committee shall consist of volunteer community members, affiliate board or staff, and Wikimedia Foundation staff. The Universal Code of Conduct has been a process strengthened by the skills and knowledge of the community and I look forward to what the U4C Building Committee creates. If you are interested in joining the Building Committee, please either [[m:Special:MyLanguage/Universal_Code_of_Conduct/U4C_Building_Committee/Nominations|sign up on the Meta-Wiki page]], or contact ucocproject[[File:At sign.svg|16x16px|link=|(_AT_)]]wikimedia.org by May 12, 2023. '''[[m:Special:MyLanguage/Universal_Code_of_Conduct/U4C_Building_Committee|Read more on Meta-Wiki]]'''. Best regards,<br /><section end="announcement-content" /> </div> [[User:Xeno (WMF)|Xeno (WMF)]] 19:00, 26 April 2023 (UTC) <!-- Message sent by User:Xeno (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=24941045 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Selection of the U4C Building Committee</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> The next stage in the Universal Code of Conduct process is establishing a Building Committee to create the charter for the Universal Code of Conduct Coordinating Committee (U4C). The Building Committee has been selected. [[m:Special:MyLanguage/Universal_Code_of_Conduct/U4C_Building_Committee|Read about the members and the work ahead on Meta-wiki]].<section end="announcement-content" /> </div> -- [[m:Special:MyLanguage/Universal_Code_of_Conduct/Project|UCoC Project Team]], 04:20, 27 Mei 2023 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25018085 --> == <span lang="en" dir="ltr" class="mw-content-ltr"> Announcing the new Elections Committee members</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Wikimedia Foundation elections committee/Nominatons/2023/Announcement - new members|You can find this message translated into additional languages on Meta-wiki.]]'' :''<div class="plainlinks">[[m:Special:MyLanguage/Wikimedia Foundation elections committee/Nominatons/2023/Announcement - new members|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Wikimedia Foundation elections committee/Nominatons/2023/Announcement - new members}}&language=&action=page&filter= {{int:please-translate}}]</div>'' Hello there, We are glad to announce [[listarchive:list/wikimedia-l@lists.wikimedia.org/message/4TALOUFPAP2VDBR27GKRVOP7IGQYU3DB/|the new members and advisors of the Elections Committee]]. The [[m:Special:MyLanguage/Wikimedia_Foundation_elections_committee|Elections Committee]] assists with the design and implementation of the process to select Community- and Affiliate-Selected trustees for the Wikimedia Foundation Board of Trustees. After an open nomination process, the strongest candidates spoke with the Board and four candidates were asked to join the Elections Committee. Four other candidates were asked to participate as advisors. Thank you to all the community members who submitted their names for consideration. We look forward to working with the Elections Committee in the near future. On behalf of the Wikimedia Foundation Board of Trustees,<br /><section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 17:59, 28 Junie 2023 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25018085 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Review the Charter for the Universal Code of Conduct Coordinating Committee</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''<div class="plainlinks">[[m:Special:MyLanguage/Universal Code of Conduct/U4C Building Committee/Announcement - Review|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/U4C Building Committee/Announcement - Review}}&language=&action=page&filter= {{int:please-translate}}]</div>'' Hello all, I am pleased to share the next step in the [[foundation:Special:MyLanguage/Policy:Universal Code of Conduct|Universal Code of Conduct]] work. The [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|Universal Code of Conduct Coordinating Committee (U4C) draft charter]] is now ready for your review. The [[foundation:Special:MyLanguage/Policy:Universal Code of Conduct/Enforcement guidelines|Enforcement Guidelines]] require a [[foundation:Special:MyLanguage/Policy:Universal_Code_of_Conduct/Enforcement_guidelines#4.5_U4C_Building_Committee|Building Committee]] form to draft a charter that outlines procedures and details for a global committee to be called the [[foundation:Special:MyLanguage/Policy:Universal_Code_of_Conduct/Enforcement_guidelines#4._UCoC_Coordinating_Committee_(U4C)|Universal Code of Conduct Coordinating Committee (U4C)]]. Over the past few months, the U4C Building Committee worked together as a group to discuss and draft the U4C charter. The U4C Building Committee welcomes feedback about the draft charter now through 22 September 2023. After that date, the U4C Building Committee will revise the charter as needed and a community vote will open shortly afterward. Join the conversation during the [[m:Special:MyLanguage/Universal Code of Conduct/U4C Building Committee#Conversation hours|conversation hours]] or on [[m:Talk:Universal Code of Conduct/Coordinating Committee/Charter|Meta-wiki]]. Best,<br /><section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]], on behalf of the U4C Building Committee, 15:35, 28 Augustus 2023 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25392152 --> == <span lang="en" dir="ltr" class="mw-content-ltr">== Opportunities open for the Affiliations Committee, Ombuds commission, and the Case Review Committee ==</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> <div style="margin:.2em 0 .5em;margin-{{#switch:{{PAGELANGUAGE}}|ar|arc|ary|arz|azb|bcc|bgn|ckb|bqi|dv|fa|fa-af|glk|ha-arab|he|kk-arab|kk-cn|ks|ku-arab|ms-arab|mzn|pnb|prd|ps|sd|ug|ur|ydd|yi=right|left}}:3ex;"> [[m:Special:MyLanguage/Wikimedia Foundation Legal department/Committee appointments/Announcement/Short|''You can find this message translated into additional languages on Meta-wiki.'']] ''<span class="plainlinks">[[m:Special:MyLanguage/Wikimedia Foundation Legal department/Committee appointments/Announcement/Short|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Wikimedia Foundation Legal department/Committee appointments/Announcement/Short}}&language=&action=page&filter= {{int:please-translate}}]</span>''</div> Hi everyone! The [[m:Special:MyLanguage/Affiliations Committee|Affiliations Committee]] (AffCom), [[m:Special:MyLanguage/Ombuds_commission|Ombuds commission]] (OC), and the [[m:Special:MyLanguage/Trust_and_Safety/Case_Review_Committee|Case Review Committee]] (CRC) are looking for new members. These volunteer groups provide important structural and oversight support for the community and movement. People are encouraged to nominate themselves or encourage others they feel would contribute to these groups to apply. There is more information about the roles of the groups, the skills needed, and the opportunity to apply on the [[m:Special:MyLanguage/Wikimedia Foundation Legal department/Committee appointments|'''Meta-wiki page''']]. On behalf of the Committee Support team,<br /><section end="announcement-content" /> </div> <div lang="en" dir="ltr" class="mw-content-ltr"> ~ [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) 16:41, 9 Oktober 2023 (UTC) </div> <!-- Message sent by User:Keegan (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25570445 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Review and comment on the 2024 Wikimedia Foundation Board of Trustees selection rules package</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/wiki/Wikimedia Foundation elections/2024/Announcement/Rules package review - short| You can find this message translated into additional languages on Meta-wiki.]]'' :''<div class="plainlinks">[[m:Special:MyLanguage/wiki/Wikimedia Foundation elections/2024/Announcement/Rules package review - short|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:wiki/Wikimedia Foundation elections/2024/Announcement/Rules package review - short}}&language=&action=page&filter= {{int:please-translate}}]</div>'' Dear all, Please review and comment on the Wikimedia Foundation Board of Trustees selection rules package from now until 29 October 2023. The selection rules package was based on older versions by the Elections Committee and will be used in the 2024 Board of Trustees selection. Providing your comments now will help them provide a smoother, better Board selection process. [[m:Special:MyLanguage/Wikimedia Foundation elections/2024|More on the Meta-wiki page]]. Best, Katie Chan <br> Chair of the Elections Committee<br /><section end="announcement-content" /> </div> 01:12, 17 Oktober 2023 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25570445 --> == The Vector 2022 skin as the default in two weeks? == <div lang="en" dir="ltr" class="mw-content-ltr"> ''[[mw:Special:MyLanguage/Reading/Web/Desktop Improvements/Updates/2023-10 for sister projects|Read this in your language]] • <span class=plainlinks>[https://mediawiki.org/w/index.php?title=Special:Translate&group=page-Reading%2FWeb%2FDesktop+Improvements%2FUpdates%2F2023-10+for+sister+projects&language=&action=page&filter= {{Int:please-translate}}]</span> • Please tell other users about these changes'' Hello. I'm writing on behalf of the [[mw:Reading/Web|Wikimedia Foundation Web team]]. '''In two weeks, we would like to make the Vector 2022 skin the default on this wiki.''' [[File:Desktop Improvements - how to enable globally.png|thumb|[[Special:GlobalPreferences|{{int:globalpreferences}}]]]] '''If you prefer keeping the current skin''' select "Vector legacy (2010)" on [[Special:GlobalPreferences#mw-prefsection-rendering|the appearance tab of the global preferences]] and save the change. We encourage you to give the new skin a try, though. Since I last came to you with this question, many things have changed. The skin is now the default on most Wikipedias, and all logos are done! We have also made some tweaks in the skin itself. Below is the text I've sent to you once, but I'm sending it again, just slightly edited, for those who haven't seen it. If you know what this is about, jump straight to the section "Our plan": <div style="margin-left:.5em; border-left:3px dotted #a2a9b1; padding-left:.5em;"> It would become the default for all logged-out users, and also all logged-in users who currently use Vector legacy as a [[Special:Preferences#mw-prefsection-rendering|local]] (but not global) preference. Logged-in users can at any time switch to any other skin. No changes are expected for these skins. <div style="width:100%; margin:auto;"><gallery widths="250" heights="180" mode="packed" caption="Top of an article"> Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2010 top.png|Vector legacy (current default) Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2022 top.png|Vector 2022 </gallery><gallery widths="250" heights="180" mode="packed" caption="A section of an article"> Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2010 scrolled.png|Vector legacy (current default) Screenshot Historia da moeda do Tíbet - 2022-09-22 - Vector 2022 scrolled.png|Vector 2022 </gallery></div> === About the skin === [[File:Wikimania 2022 Vector (2022) Presentation.pdf|thumb|Slides to our Wikimania 2022 presentation. [https://www.youtube.com/watch?v=yC-ItaXDe2A You may also listen to the recording on YouTube (in English)].]] '''[Why is a change necessary]''' When the current default skin was created, it reflected the needs of the readers and editors as these were 14 years ago. Since then, new users have begun using the Internet and Wikimedia projects in different ways. [[wmfblog:2022/08/18/prioritizing-equity-within-wikipedias-new-desktop/|The old Vector does not meet their needs]]. '''[Objective]''' The objective for the Vector 2022 skin is to make the interface more welcoming and comfortable for readers and useful for advanced users. It introduces a series of changes that aim to improve problems new and existing readers and editors were having with the old skin. It draws inspiration from previous user requests, the [[metawiki:Special:MyLanguage/Community_Wishlist_Survey|Community Wishlist Surveys]], and gadgets and scripts. The work helped our code follow the standards and improve all other skins. [[phab:phame/post/view/290/how_and_why_we_moved_our_skins_to_mustache/|The PHP code in the other available skins has been reduced by 75%]]. The project has also focused on making it easier to support gadgets and use APIs. [[File:Screenshot of the Vector-2022 skin's fullscreen toggle.png|thumb]] '''[Changes in a nutshell]''' The skin introduces changes that improve readability and usability. The new skin does not remove any functionality currently available on the Vector skin. * The limited width and pin-able menus allow to adjust the interface to the screen size, and focus on editing or reading. Logged-in and logged-out users may use a toggle button to keep the full width, though. * The sticky header makes it easier to find tools that editors use often. It decreases scrolling to the top of the page by 16%. * The new table of contents makes it easier to navigate to different sections. Readers and editors jump to different sections of the page 50% more than with the old table of contents. It also looks a bit different on talk pages. * The new search bar is easier to find and makes it easier to find the correct search result from the list. This increased the amount of searches started by 30% on the tested wikis. * The skin does not negatively affect pageviews, edit rates, or account creation. There is evidence of increases in pageviews and account creation across partner communities. '''[Customize this skin]''' It's possible to configure and personalize our changes. We support volunteers who create new gadgets and user scripts. Check out [[mw:Special:MyLanguage/Reading/Web/Desktop Improvements/Repository|the repository]] for a list of currently available customizations and changes, or add your own. </div> === Our plan === '''If no large concerns are raised, we plan on deploying on 31 October'''. If you'd like to ask our team anything, if you have questions, concerns, or additional thoughts, please comment in any language. If this is the first comment to my message, make sure to ping me. We will gladly answer! Also, check out [[mw:Reading/Web/Desktop Improvements/Frequently asked questions|our FAQ]]. Thank you! [[User:SGrabarczuk (WMF)|SGrabarczuk (WMF)]] ([[User talk:SGrabarczuk (WMF)|<span class="signature-talk">Besprekings</span>]]) 23:51, 18 Oktober 2023 (UTC) </div> <!-- Message sent by User:SGrabarczuk (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:SGrabarczuk_(WMF)/sandbox/MM/Varia&oldid=25764915 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Vote on the Charter for the Universal Code of Conduct Coordinating Committee</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - voting opens|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - voting opens}}&language=&action=page&filter= {{int:please-translate}}]'' Hello all, I am reaching out to you today to announce that the voting period for the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee|Universal Code of Conduct Coordinating Committee]] (U4C) Charter is now open. Community members may [[m:Special:MyLanguage/Universal_Code_of_Conduct/Coordinating_Committee/Charter/Voter_information|cast their vote and provide comments about the charter via SecurePoll]] now through '''2 February 2024'''. Those of you who voiced your opinions during the development of the [[foundation:Special:MyLanguage/Policy:Universal_Code_of_Conduct/Enforcement_guidelines|UCoC Enforcement Guidelines]] will find this process familiar. The [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|current version of the U4C Charter]] is on Meta-wiki with translations available. Read the charter, go vote and share this note with others in your community. I can confidently say the U4C Building Committee looks forward to your participation. On behalf of the UCoC Project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 18:07, 19 Januarie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25853527 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Last days to vote on the Charter for the Universal Code of Conduct Coordinating Committee</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - voting reminder|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - voting reminder}}&language=&action=page&filter= {{int:please-translate}}]'' Hello all, I am reaching out to you today to remind you that the voting period for the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee|Universal Code of Conduct Coordinating Committee]] (U4C) charter will close on '''2 February 2024'''. Community members may [[m:Special:MyLanguage/Universal_Code_of_Conduct/Coordinating_Committee/Charter/Voter_information|cast their vote and provide comments about the charter via SecurePoll]]. Those of you who voiced your opinions during the development of the [[foundation:Special:MyLanguage/Policy:Universal_Code_of_Conduct/Enforcement_guidelines|UCoC Enforcement Guidelines]] will find this process familiar. The [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|current version of the U4C charter]] is on Meta-wiki with translations available. Read the charter, go vote and share this note with others in your community. I can confidently say the U4C Building Committee looks forward to your participation. On behalf of the UCoC Project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 16:59, 31 Januarie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=25853527 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Announcing the results of the UCoC Coordinating Committee Charter ratification vote</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - results|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:wiki/Universal Code of Conduct/Coordinating Committee/Charter/Announcement - results}}&language=&action=page&filter= {{int:please-translate}}]'' Dear all, Thank you everyone for following the progress of the Universal Code of Conduct. I am writing to you today to announce the outcome of the [[m:Special:MyLanguage/Universal_Code_of_Conduct/Coordinating_Committee/Charter/Voter_information|ratification vote]] on the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|Universal Code of Conduct Coordinating Committee Charter]]. 1746 contributors voted in this ratification vote with 1249 voters supporting the Charter and 420 voters not. The ratification vote process allowed for voters to provide comments about the Charter. A report of voting statistics and a summary of voter comments will be published on Meta-wiki in the coming weeks. Please look forward to hearing about the next steps soon. On behalf of the UCoC Project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 18:23, 12 Februarie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26160150 --> == <span lang="en" dir="ltr" class="mw-content-ltr"> Report of the U4C Charter ratification and U4C Call for Candidates now available</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – call for candidates| You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – call for candidates}}&language=&action=page&filter= {{int:please-translate}}]'' Hello all, I am writing to you today with two important pieces of information. First, the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter/Vote results|report of the comments from the Universal Code of Conduct Coordinating Committee (U4C) Charter ratification]] is now available. Secondly, the call for candidates for the U4C is open now through April 1, 2024. The [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee|Universal Code of Conduct Coordinating Committee]] (U4C) is a global group dedicated to providing an equitable and consistent implementation of the UCoC. Community members are invited to submit their applications for the U4C. For more information and the responsibilities of the U4C, please [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|review the U4C Charter]]. Per the charter, there are 16 seats on the U4C: eight community-at-large seats and eight regional seats to ensure the U4C represents the diversity of the movement. Read more and submit your application on [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024|Meta-wiki]]. On behalf of the UCoC project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 16:24, 5 Maart 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26276337 --> == <span lang="en" dir="ltr" class="mw-content-ltr"> Wikimedia Foundation Board of Trustees 2024 Selection</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> : ''[[m:Special:MyLanguage/Wikimedia Foundation elections/2024/Announcement/Selection announcement| You can find this message translated into additional languages on Meta-wiki.]]'' : ''<div class="plainlinks">[[m:Special:MyLanguage/Wikimedia Foundation elections/2024/Announcement/Selection announcement|{{int:interlanguage-link-mul}}]] • [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Wikimedia Foundation elections/2024/Announcement/Selection announcement}}&language=&action=page&filter= {{int:please-translate}}]</div>'' Dear all, This year, the term of 4 (four) Community- and Affiliate-selected Trustees on the Wikimedia Foundation Board of Trustees will come to an end [1]. The Board invites the whole movement to participate in this year’s selection process and vote to fill those seats. The [[m:Special:MyLanguage/Wikimedia Foundation elections committee|Elections Committee]] will oversee this process with support from Foundation staff [2]. The Board Governance Committee created a Board Selection Working Group from Trustees who cannot be candidates in the 2024 community- and affiliate-selected trustee selection process composed of Dariusz Jemielniak, Nataliia Tymkiv, Esra'a Al Shafei, Kathy Collins, and Shani Evenstein Sigalov [3]. The group is tasked with providing Board oversight for the 2024 trustee selection process, and for keeping the Board informed. More details on the roles of the Elections Committee, Board, and staff are here [4]. Here are the key planned dates: * May 2024: Call for candidates and call for questions * June 2024: Affiliates vote to shortlist 12 candidates (no shortlisting if 15 or less candidates apply) [5] * June-August 2024: Campaign period * End of August / beginning of September 2024: Two-week community voting period * October–November 2024: Background check of selected candidates * Board's Meeting in December 2024: New trustees seated Learn more about the 2024 selection process - including the detailed timeline, the candidacy process, the campaign rules, and the voter eligibility criteria - on [[m:Special:MyLanguage/Wikimedia Foundation elections/2024|this Meta-wiki page]], and make your plan. '''Election Volunteers''' Another way to be involved with the 2024 selection process is to be an Election Volunteer. Election Volunteers are a bridge between the Elections Committee and their respective community. They help ensure their community is represented and mobilize them to vote. Learn more about the program and how to join on this [[m:Special:MyLanguage/Wikimedia Foundation elections/2024/Election Volunteers|Meta-wiki page]]. Best regards, [[m:Special:MyLanguage/User:Pundit|Dariusz Jemielniak]] (Governance Committee Chair, Board Selection Working Group) [1] https://meta.wikimedia.org/wiki/Special:MyLanguage/Wikimedia_Foundation_elections/2021/Results#Elected [2] https://foundation.wikimedia.org/wiki/Committee:Elections_Committee_Charter [3] https://foundation.wikimedia.org/wiki/Minutes:2023-08-15#Governance_Committee [4] https://meta.wikimedia.org/wiki/Wikimedia_Foundation_elections_committee/Roles [5] Even though the ideal number is 12 candidates for 4 open seats, the shortlisting process will be triggered if there are more than 15 candidates because the 1-3 candidates that are removed might feel ostracized and it would be a lot of work for affiliates to carry out the shortlisting process to only eliminate 1-3 candidates from the candidate list.<section end="announcement-content" /> </div> [[User:MPossoupe_(WMF)|MPossoupe_(WMF)]]19:56, 12 Maart 2024 (UTC) <!-- Message sent by User:MPossoupe (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26349432 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Vote now to select members of the first U4C</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – vote opens|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – vote opens}}&language=&action=page&filter= {{int:please-translate}}]'' Dear all, I am writing to you to let you know the voting period for the Universal Code of Conduct Coordinating Committee (U4C) is open now through May 9, 2024. Read the information on the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024|voting page on Meta-wiki]] to learn more about voting and voter eligibility. The Universal Code of Conduct Coordinating Committee (U4C) is a global group dedicated to providing an equitable and consistent implementation of the UCoC. Community members were invited to submit their applications for the U4C. For more information and the responsibilities of the U4C, please [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|review the U4C Charter]]. Please share this message with members of your community so they can participate as well. On behalf of the UCoC project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 20:19, 25 April 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26390244 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Sign up for the language community meeting on May 31st, 16:00 UTC</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="message"/>Hello all, The next language community meeting is scheduled in a few weeks - May 31st at 16:00 UTC. If you're interested, you can [https://www.mediawiki.org/w/index.php?title=Wikimedia_Language_engineering/Community_meetings#31_May_2024 sign up on this wiki page]. This is a participant-driven meeting, where we share language-specific updates related to various projects, collectively discuss technical issues related to language wikis, and work together to find possible solutions. For example, in the last meeting, the topics included the machine translation service (MinT) and the languages and models it currently supports, localization efforts from the Kiwix team, and technical challenges with numerical sorting in files used on Bengali Wikisource. Do you have any ideas for topics to share technical updates related to your project? Any problems that you would like to bring for discussion during the meeting? Do you need interpretation support from English to another language? Please reach out to me at ssethi(__AT__)wikimedia.org and [[etherpad:p/language-community-meeting-may-2024|add agenda items to the document here]]. We look forward to your participation! <section end="message"/> </div> <bdi lang="en" dir="ltr">[[User:MediaWiki message delivery|MediaWiki message delivery]]</bdi> 21:21, 14 Mei 2024 (UTC) <!-- Message sent by User:SSethi (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26390244 --> == <span lang="en" dir="ltr" class="mw-content-ltr"> Feedback invited on Procedure for Sibling Project Lifecycle</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Wikimedia Foundation Community Affairs Committee/Procedure for Sibling Project Lifecycle/Invitation for feedback (MM)|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Wikimedia Foundation Community Affairs Committee/Procedure for Sibling Project Lifecycle/Invitation for feedback (MM)}}&language=&action=page&filter= {{int:please-translate}}]'' [[File:Sibling Project Lifecycle Conversation 3.png|150px|right|link=:m:Special:MyLanguage/Wikimedia Foundation Community Affairs Committee/Procedure for Sibling Project Lifecycle]] Dear community members, The [[:m:Special:MyLanguage/Wikimedia Foundation Community Affairs Committee|Community Affairs Committee]] (CAC) of the [[:m:Special:MyLanguage/Wikimedia Foundation Board of Trustees|Wikimedia Foundation Board of Trustees]] invites you to give feedback on a '''[[:m:Special:MyLanguage/Wikimedia Foundation Community Affairs Committee/Procedure for Sibling Project Lifecycle|draft Procedure for Sibling Project Lifecycle]]'''. This draft Procedure outlines proposed steps and requirements for opening and closing Wikimedia Sibling Projects, and aims to ensure any newly approved projects are set up for success. This is separate from the procedures for opening or closing language versions of projects, which is handled by the [[:m:Special:MyLanguage/Language committee|Language Committee]] or [[m:Special:MyLanguage/Closing_projects_policy|closing projects policy]]. You can find the details on [[:m:Special:MyLanguage/Talk:Wikimedia Foundation Community Affairs Committee/Procedure for Sibling Project Lifecycle#Review|this page]], as well as the ways to give your feedback from today until the end of the day on '''June 23, 2024''', anywhere on Earth. You can also share information about this with the interested project communities you work with or support, and you can also help us translate the procedure into more languages, so people can join the discussions in their own language. On behalf of the CAC,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 02:24, 22 Mei 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26390244 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Announcing the first Universal Code of Conduct Coordinating Committee</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – results|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/Coordinating Committee/Election/2024/Announcement – results}}&language=&action=page&filter= {{int:please-translate}}]'' Hello, The scrutineers have finished reviewing the vote results. We are following up with the results of the first [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024|Universal Code of Conduct Coordinating Committee (U4C) election]]. We are pleased to announce the following individuals as regional members of the U4C, who will fulfill a two-year term: * North America (USA and Canada) ** – * Northern and Western Europe ** [[m:Special:MyLanguage/User:Ghilt|Ghilt]] * Latin America and Caribbean ** – * Central and East Europe (CEE) ** — * Sub-Saharan Africa ** – * Middle East and North Africa ** [[m:Special:MyLanguage/User:Ibrahim.ID|Ibrahim.ID]] * East, South East Asia and Pacific (ESEAP) ** [[m:Special:MyLanguage/User:0xDeadbeef|0xDeadbeef]] * South Asia ** – The following individuals are elected to be community-at-large members of the U4C, fulfilling a one-year term: * [[m:Special:MyLanguage/User:Barkeep49|Barkeep49]] * [[m:Special:MyLanguage/User:Superpes15|Superpes15]] * [[m:Special:MyLanguage/User:Civvì|Civvì]] * [[m:Special:MyLanguage/User:Luke081515|Luke081515]] * – * – * – * – Thank you again to everyone who participated in this process and much appreciation to the candidates for your leadership and dedication to the Wikimedia movement and community. Over the next few weeks, the U4C will begin meeting and planning the 2024-25 year in supporting the implementation and review of the UCoC and Enforcement Guidelines. Follow their work on [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee|Meta-wiki]]. On behalf of the UCoC project team,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 08:14, 3 Junie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26390244 --> == <span lang="en" dir="ltr" class="mw-content-ltr">The final text of the Wikimedia Movement Charter is now on Meta</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Movement Charter/Drafting Committee/Announcement - Final draft available|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Movement Charter/Drafting Committee/Announcement - Final draft available}}&language=&action=page&filter= {{int:please-translate}}]'' Hi everyone, The final text of the [[m:Special:MyLanguage/Movement Charter|Wikimedia Movement Charter]] is now up on Meta in more than 20 languages for your reading. '''What is the Wikimedia Movement Charter?''' The Wikimedia Movement Charter is a proposed document to define roles and responsibilities for all the members and entities of the Wikimedia movement, including the creation of a new body – the Global Council – for movement governance. '''Join the Wikimedia Movement Charter “Launch Party”''' Join the [[m:Special:MyLanguage/Event:Movement Charter Launch Party|“Launch Party”]] on '''June 20, 2024''' at '''14.00-15.00 UTC''' ([https://zonestamp.toolforge.org/1718892000 your local time]). During this call, we will celebrate the release of the final Charter and present the content of the Charter. Join and learn about the Charter before casting your vote. '''Movement Charter ratification vote''' Voting will commence on SecurePoll on '''June 25, 2024''' at '''00:01 UTC''' and will conclude on '''July 9, 2024''' at '''23:59 UTC.''' You can read more about the [[m:Special:MyLanguage/Movement Charter/Ratification/Voting|voting process, eligibility criteria, and other details]] on Meta. If you have any questions, please leave a comment on the [[m:Special:MyLanguage/Talk:Movement Charter|Meta talk page]] or email the MCDC at [mailto:mcdc@wikimedia.org mcdc@wikimedia.org]. On behalf of the MCDC,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 08:44, 11 Junie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26390244 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Voting to ratify the Wikimedia Movement Charter is now open – cast your vote</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Movement Charter/Drafting Committee/Announcement - Ratification vote opens|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Movement Charter/Drafting Committee/Announcement - Ratification vote opens}}&language=&action=page&filter= {{int:please-translate}}]'' Hello everyone, The voting to ratify the [[m:Special:MyLanguage/Movement Charter|'''Wikimedia Movement Charter''']] is now open. The Wikimedia Movement Charter is a document to define roles and responsibilities for all the members and entities of the Wikimedia movement, including the creation of a new body – the Global Council – for movement governance. The final version of the Wikimedia Movement Charter is [[m:Special:MyLanguage/Movement Charter|available on Meta in different languages]] and attached [https://commons.wikimedia.org/wiki/File:Wikimedia_Movement_Charter_(June_2024).pdf here in PDF format] for your reading. Voting commenced on SecurePoll on '''June 25, 2024''' at '''00:01 UTC''' and will conclude on '''July 9, 2024''' at '''23:59 UTC'''. Please read more on the [[m:Special:MyLanguage/Movement Charter/Ratification/Voting|voter information and eligibility details]]. After reading the Charter, please [[Special:SecurePoll/vote/398|'''vote here''']] and share this note further. If you have any questions about the ratification vote, please contact the Charter Electoral Commission at [mailto:cec@wikimedia.org '''cec@wikimedia.org''']. On behalf of the CEC,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 10:51, 25 Junie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26989444 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Voting to ratify the Wikimedia Movement Charter is ending soon</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Movement Charter/Drafting Committee/Announcement - Final reminder|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Movement Charter/Drafting Committee/Announcement - Final reminder}}&language=&action=page&filter= {{int:please-translate}}]'' Hello everyone, This is a kind reminder that the voting period to ratify the [[m:Special:MyLanguage/Movement Charter|Wikimedia Movement Charter]] will be closed on '''July 9, 2024''', at '''23:59 UTC'''. If you have not voted yet, please vote [[m:Special:SecurePoll/vote/398|on SecurePoll]]. On behalf of the [[m:Special:MyLanguage/Movement_Charter/Ratification/Voting#Electoral_Commission|Charter Electoral Commission]],<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 03:45, 8 Julie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26989444 --> == <span lang="en" dir="ltr" class="mw-content-ltr">U4C Special Election - Call for Candidates</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election/Announcement – call for candidates|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election/Announcement – call for candidates}}&language=&action=page&filter= {{int:please-translate}}]'' Hello all, A special election has been called to fill additional vacancies on the U4C. The call for candidates phase is open from now through July 19, 2024. The [[:m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee|Universal Code of Conduct Coordinating Committee]] (U4C) is a global group dedicated to providing an equitable and consistent implementation of the [[:foundation:Wikimedia Foundation Universal Code of Conduct|UCoC]]. Community members are invited to submit their applications in the special election for the U4C. For more information and the responsibilities of the U4C, please review the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|U4C Charter]]. In this special election, according to [[Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter#2. Elections and Terms|chapter 2 of the U4C charter]], there are 9 seats available on the U4C: '''four''' community-at-large seats and '''five''' regional seats to ensure the U4C represents the diversity of the movement. [[Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter#5. Glossary|No more than two members of the U4C can be elected from the same home wiki]]. Therefore, candidates must not have English Wikipedia, German Wikipedia, or Italian Wikipedia as their home wiki. Read more and submit your application on [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election|Meta-wiki]]. In cooperation with the U4C,<section end="announcement-content" /> </div> -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) 00:02, 10 Julie 2024 (UTC) <!-- Message sent by User:Keegan (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26989444 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Wikimedia Movement Charter ratification voting results</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Movement Charter/Drafting Committee/Announcement - Results of the ratification vote|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Movement Charter/Drafting Committee/Announcement - Results of the ratification vote}}&language=&action=page&filter= {{int:please-translate}}]'' Hello everyone, After carefully tallying both individual and affiliate votes, the [[m:Special:MyLanguage/Movement Charter/Ratification/Voting#Electoral Commission|Charter Electoral Commission]] is pleased to announce the final results of the Wikimedia Movement Charter voting.   As [[m:Special:MyLanguage/Talk:Movement Charter#Thank you for your participation in the Movement Charter ratification vote!|communicated]] by the Charter Electoral Commission, we reached the quorum for both Affiliate and individual votes by the time the vote closed on '''July 9, 23:59 UTC'''. We thank all 2,451 individuals and 129 Affiliate representatives who voted in the ratification process. Your votes and comments are invaluable for the future steps in Movement Strategy. The final results of the [[m:Special:MyLanguage/Movement Charter|Wikimedia Movement Charter]] ratification voting held between 25 June and 9 July 2024 are as follows: '''Individual vote:''' Out of 2,451 individuals who voted as of July 9 23:59 (UTC), 2,446 have been accepted as valid votes. Among these, '''1,710''' voted “yes”; '''623''' voted “no”; and '''113''' selected “–” (neutral). Because the neutral votes don’t count towards the total number of votes cast, 73.30% voted to approve the Charter (1710/2333), while 26.70% voted to reject the Charter (623/2333). '''Affiliates vote:''' Out of 129 Affiliates designated voters who voted as of July 9 23:59 (UTC), 129 votes are confirmed as valid votes. Among these, '''93''' voted “yes”; '''18''' voted “no”; and '''18''' selected “–” (neutral). Because the neutral votes don’t count towards the total number of votes cast, 83.78% voted to approve the Charter (93/111), while 16.22% voted to reject the Charter (18/111). '''Board of Trustees of the Wikimedia Foundation:''' The Wikimedia Foundation Board of Trustees voted '''not to ratify''' the proposed Charter during their special Board meeting on July 8, 2024. The Chair of the Wikimedia Foundation Board of Trustees, Nataliia Tymkiv, [[m:Special:MyLanguage/Wikimedia_Foundation_Board_noticeboard/Board_resolution_and_vote_on_the_proposed_Movement_Charter|shared the result of the vote, the resolution, meeting minutes and proposed next steps]].   With this, the Wikimedia Movement Charter in its current revision is '''not ratified'''. We thank you for your participation in this important moment in our movement’s governance. The Charter Electoral Commission, [[m:User:Abhinav619|Abhinav619]], [[m:User:Borschts|Borschts]], [[m:User:Iwuala Lucy|Iwuala Lucy]], [[m:User:Tochiprecious|Tochiprecious]], [[m:User:Der-Wir-Ing|Der-Wir-Ing]]<section end="announcement-content" /> </div> [[Gebruiker:MediaWiki message delivery|MediaWiki message delivery]] ([[Gebruikerbespreking:MediaWiki message delivery|kontak]]) 17:51, 18 Julie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26989444 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Vote now to fill vacancies of the first U4C</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="announcement-content" /> :''[[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election/Announcement – voting opens|You can find this message translated into additional languages on Meta-wiki.]] [https://meta.wikimedia.org/w/index.php?title=Special:Translate&group=page-{{urlencode:Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election/Announcement – voting opens}}&language=&action=page&filter= {{int:please-translate}}]'' Dear all, I am writing to you to let you know the voting period for the Universal Code of Conduct Coordinating Committee (U4C) is open now through '''August 10, 2024'''. Read the information on the [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Election/2024 Special Election|voting page on Meta-wiki]] to learn more about voting and voter eligibility. The Universal Code of Conduct Coordinating Committee (U4C) is a global group dedicated to providing an equitable and consistent implementation of the UCoC. Community members were invited to submit their applications for the U4C. For more information and the responsibilities of the U4C, please [[m:Special:MyLanguage/Universal Code of Conduct/Coordinating Committee/Charter|review the U4C Charter]]. Please share this message with members of your community so they can participate as well. In cooperation with the U4C,<section end="announcement-content" /> </div> [[m:User:RamzyM (WMF)|RamzyM (WMF)]] 02:46, 27 Julie 2024 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Distribution_list/Global_message_delivery&oldid=26989444 --> e84uxxhppzmgu0j0ouzvqzyjx2yhz4q Duits/Grammatika 0 2063 6647 6646 2020-05-21T10:24:52Z Hamish 2161 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6471 wikitext text/x-wiki * [[Duits/Grammatika/Geslag]] * [[Duits/Grammatika/Persoonlike voornaamwoorde]] * [[Duits/Grammatika/Persoonlike voornaamwoorde (meervoud)]] * [[Duits/Grammatika/Werkwoorde]] * [[Duits/Grammatika/Werkwoorde (meervoud)]] * [[Duits/Grammatika/Naamval]] * [[Duits/Grammatika/Lidwoorde]] * [[Duits/Grammatika/Verkleinwoorde]] * [[Duits/Grammatika/Telwoorde]] * [[Duits/Grammatika/Tyd]] * [[Duits/Grammatika/Naamwoorde]] * [[Duits/Grammatika/Selfstandige naamwoorde (meervoud)]] [[en:German/Grammar]] [[ka:გერმანული ენა/გრამატიკა]] 1of7yw0p2i90wznjc472kkybmnkpavs Gebruiker:Andbrew.downes 2 2064 3797 2009-10-09T22:19:43Z Andbrew.downes 409 New page 3797 wikitext text/x-wiki Hi I keep my Wikipedia profile more up to date. The main interests that I will be contributing to as and when I have the time. * '''Brewing''' - particularly the practical aspects of professional brewing - shop floor stuff. * '''Beekeeping''' - a little hobby of mine - working with "African Bees" as opposed to Africanized bees * '''Environmental topics''' nature conservation, zoology and "all things bright and beautiful" * '''Scouting''' - seems a little bit thin in wikibooks En aan my Afrikaanse broeders en susters... as ek kans kry sal ek ook so nou an dan 'n draai maak en daar so bietjie help. Dit i s my tweede taal so as my sin konstruksie effens snaaks is, jy kan maar reg maak dis orrait. Hier gaan ek myself slegs by dierkunde, natuur en omgewings sake hou - want die ander vakke ken ek slegs in Engels. beu3uh40dfvul9d7mpop4ba7e8afd8c Wikibooks:Bot policy 4 2065 3798 2009-10-14T11:01:39Z Carsrac 395 Stuur aan na [[Wikibooks:Gebruikersportaal]] 3798 wikitext text/x-wiki #redirect[[Wikibooks:Gebruikersportaal]] 1qsh8l15d7tle6n9zqmy058z5e0mglu Gebruiker:Ciphers 2 2066 3799 2009-10-21T12:41:14Z Ciphers 268 Nuwe bladsy geskep met '{{Babel|ar|en-4|ja-4|de-2|zh-1|fr-1}} You May Find me at: * [[:en:User:Ciphers]] * [[m:User:Ciphers]] * [[:ar:مستخدم:Ciphers]] [[ar:مستخدم:Ciphers]] [[en:User...' 3799 wikitext text/x-wiki {{Babel|ar|en-4|ja-4|de-2|zh-1|fr-1}} You May Find me at: * [[:en:User:Ciphers]] * [[m:User:Ciphers]] * [[:ar:مستخدم:Ciphers]] [[ar:مستخدم:Ciphers]] [[en:User:Ciphers]] [[de:Benutzer:Ciphers]] nmxnkkw8zrc8bqo2nogjljl2cfbrpvt Gebruiker:Barras 2 2067 3813 2009-11-01T13:22:05Z Barras 415 Nuwe bladsy geskep met '[[m:User:Barras|>>>]]' 3813 wikitext text/x-wiki [[m:User:Barras|>>>]] cdvi63wxrv8gkd3jonxs4lgdygdiaj8 Gebruiker:Gaudio 2 2068 3814 2009-11-02T19:23:44Z Gaudio 423 Nuwe bladsy geskep met '[[meta:User:Gaudio]]' 3814 wikitext text/x-wiki [[meta:User:Gaudio]] mr6vnvladoz3xj8fgm9hne0a55m2dnh Gebruiker:Juliancolton 2 2069 3815 2009-11-04T04:38:50Z Juliancolton 335 Nuwe bladsy geskep met 'Hi, I'm Juliancolton. See my [[m:User:Juliancolton|Meta-Wiki userpage]] for more information.' 3815 wikitext text/x-wiki Hi, I'm Juliancolton. See my [[m:User:Juliancolton|Meta-Wiki userpage]] for more information. 2c8fnof267atfk7b5bxfvcxta70ux47 Gebruiker:Arseny1992 2 2070 3819 2009-12-03T15:59:20Z Arseny1992 234 Nuwe bladsy geskep met '<div style="float:left; border:1px solid #bbb; margin:1px;" class="wikipediauserbox"> {| cellspacing="0" style="width:238px; background:#f6f6f6;" ! style="width:45px; height...' 3819 wikitext text/x-wiki <div style="float:left; border:1px solid #bbb; margin:1px;" class="wikipediauserbox"> {| cellspacing="0" style="width:238px; background:#f6f6f6;" ! style="width:45px; height:45px; background:#fff; text-align:center; font-size:14pt; color:black; padding:1px; line-height:1.25em; vertical-align: middle; " | [[Image:Wikimedia logo family complete.svg|50px]] | style="text-align:left; font-size:8pt; padding:4px; height:45px; line-height:1.25em; color:black; vertical-align: middle; " | <span class="plainlinks">[http://toolserver.org/~vvv/sulutil.php?user=Arseny1992 This user]</span> has created a [[:m:Help:Unified login|global account]]. Arseny1992's main account is on [[:w:ru:User:Arseny1992|Wikipedia]] <span class="languageicon" style="font-size:0.95em; font-weight:bold; color:#555;">(Russian)</span>. |}</div> [[ab:Участник:Arseny1992]] [[ace:Pengguna:Arseny1992]] [[af:Gebruiker:Arseny1992]] [[ak:User:Arseny1992]] [[als:Benutzer:Arseny1992]] [[am:አባል:Arseny1992]] [[an:Usuario:Arseny1992]] [[ang:User:Arseny1992]] [[ar:مستخدم:Arseny1992]] [[arc:ܡܬܚܫܚܢܐ:Arseny1992]] [[arz:مستخدم:Arseny1992]] [[as:সদস্য:Arseny1992]] [[ast:Usuariu:Arseny1992]] [[av:Участник:Arseny1992]] [[ay:Usuario:Arseny1992]] [[az:İstifadəçi:Arseny1992]] [[ba:Ҡатнашыусы:Arseny1992]] [[bar:Benutzer:Arseny1992]] [[bat-smg:Nauduotuos:Arseny1992]] [[bcl:Paragamit:Arseny1992]] [[be-x-old:Удзельнік:Arseny1992]] [[be:Удзельнік:Arseny1992]] [[bg:Потребител:Arseny1992]] [[bh:User:Arseny1992]] [[bi:User:Arseny1992]] [[bm:Utilisateur:Arseny1992]] [[bn:ব্যবহারকারী:Arseny1992]] [[bo:User:Arseny1992]] [[bpy:আতাকুরা:Arseny1992]] [[br:Implijer:Arseny1992]] [[bs:Korisnik:Arseny1992]] [[bug:Pengguna:Arseny1992]] [[bxr:User:Arseny1992]] [[ca:Usuari:Arseny1992]] [[cbk-zam:Usuario:Arseny1992]] [[cdo:User:Arseny1992]] [[ce:Юзер:Arseny1992]] [[ceb:Gumagamit:Arseny1992]] [[ch:Muna'sesetbi:Arseny1992]] [[chr:User:Arseny1992]] [[chy:User:Arseny1992]] [[ckb:بەکارھێنەر:Arseny1992]] [[co:User:Arseny1992]] [[cr:User:Arseny1992]] [[crh:Qullanıcı:Arseny1992]] [[cs:Wikipedista:Arseny1992]] [[csb:Brëkòwnik:Arseny1992]] [[cu:По́льꙃєватєл҄ь:Arseny1992]] [[cv:Хутшăнакан:Arseny1992]] [[cy:Defnyddiwr:Arseny1992]] [[da:Bruger:Arseny1992]] [[de:Benutzer:Arseny1992]] [[diq:User:Arseny1992]] [[dsb:Wužywaŕ:Arseny1992]] [[dv:މެމްބަރު:Arseny1992]] [[dz:User:Arseny1992]] [[ee:User:Arseny1992]] [[el:Χρήστης:Arseny1992]] [[eml:Utente:Arseny1992]] [[en:User:Arseny1992]] [[eo:Vikipediisto:Arseny1992]] [[es:Usuario:Arseny1992]] [[et:Kasutaja:Arseny1992]] [[eu:Lankide:Arseny1992]] [[ext:User:Arseny1992]] [[fa:کاربر:Arseny1992]] [[ff:Utilisateur:Arseny1992]] [[fi:Käyttäjä:Arseny1992]] [[fiu-vro:Pruukja:Arseny1992]] [[fj:User:Arseny1992]] [[fo:Brúkari:Arseny1992]] [[fr:Utilisateur:Arseny1992]] [[frp:Utilisator:Arseny1992]] [[fur:Utent:Arseny1992]] [[fy:Meidogger:Arseny1992]] [[ga:Úsáideoir:Arseny1992]] [[gan:用户:Arseny1992]] [[gd:User:Arseny1992]] [[gl:Usuario:Arseny1992]] [[glk:کاربر:Arseny1992]] [[gn:Puruhára:Arseny1992]] [[got:User:Arseny1992]] [[gu:સભ્ય:Arseny1992]] [[gv:Ymmydeyr:Arseny1992]] [[ha:User:Arseny1992]] [[hak:User:Arseny1992]] [[haw:Mea hoʻohana:Arseny1992]] [[he:משתמש:Arseny1992]] [[hi:सदस्य:Arseny1992]] [[hif:User:Arseny1992]] [[hr:Suradnik:Arseny1992]] [[hsb:Wužiwar:Arseny1992]] [[ht:Itilizatè:Arseny1992]] [[hu:Szerkesztő:Arseny1992]] [[hy:Մասնակից:Arseny1992]] [[ia:Usator:Arseny1992]] [[id:Pengguna:Arseny1992]] [[ie:User:Arseny1992]] [[ig:User:Arseny1992]] [[ik:User:Arseny1992]] [[ilo:User:Arseny1992]] [[io:Uzanto:Arseny1992]] [[is:Notandi:Arseny1992]] [[it:Utente:Arseny1992]] [[iu:User:Arseny1992]] [[ja:利用者:Arseny1992]] [[jbo:User:Arseny1992]] [[jv:Panganggo:Arseny1992]] [[ka:მომხმარებელი:Arseny1992]] [[kaa:Paydalanıwshı:Arseny1992]] [[kab:Amseqdac:Arseny1992]] [[kg:User:Arseny1992]] [[ki:User:Arseny1992]] [[kk:Қатысушы:Arseny1992]] [[kl:Atuisoq:Arseny1992]] [[km:អ្នកប្រើប្រាស់:Arseny1992]] [[kn:ಸದಸ್ಯ:Arseny1992]] [[ko:사용자:Arseny1992]] [[ks:User:Arseny1992]] [[ksh:Metmaacher:Arseny1992]] [[ku:Bikarhêner:Arseny1992]] [[kv:Участник:Arseny1992]] [[kw:Devnydhyer:Arseny1992]] [[ky:User:Arseny1992]] [[la:Usor:Arseny1992]] [[lad:Usuario:Arseny1992]] [[lb:Benotzer:Arseny1992]] [[lbe:Гьуртту хьума:Arseny1992]] [[lg:User:Arseny1992]] [[li:Gebroeker:Arseny1992]] [[lij:Utente:Arseny1992]] [[lmo:Druvat:Arseny1992]] [[ln:Utilisateur:Arseny1992]] [[lo:ຜູ້ໃຊ້:Arseny1992]] [[lt:Naudotojas:Arseny1992]] [[lv:Lietotājs:Arseny1992]] [[map-bms:Panganggo:Arseny1992]] [[mdf:Тиись:Arseny1992]] [[mg:Mpikambana:Arseny1992]] [[mhr:Пайдаланыше:Arseny1992]] [[mi:User:Arseny1992]] [[mk:Корисник:Arseny1992]] [[ml:ഉപയോക്താവ്:Arseny1992]] [[mn:Хэрэглэгч:Arseny1992]] [[mr:सदस्य:Arseny1992]] [[ms:Pengguna:Arseny1992]] [[mt:Utent:Arseny1992]] [[mwl:Outelizador:Arseny1992]] [[my:User:Arseny1992]] [[myv:Теиця:Arseny1992]] [[mzn:کارور:Arseny1992]] [[na:User:Arseny1992]] [[nah:Tlatequitiltilīlli:Arseny1992]] [[nap:Utente:Arseny1992]] [[nds-nl:Gebruker:Arseny1992]] [[nds:Bruker:Arseny1992]] [[ne:User:Arseny1992]] [[new:छ्येलेमि:Arseny1992]] [[ng:User:Arseny1992]] [[nl:Gebruiker:Arseny1992]] [[nn:Brukar:Arseny1992]] [[no:Bruker:Arseny1992]] [[nov:User:Arseny1992]] [[nrm:User:Arseny1992]] [[nv:Choinish'įįhí:Arseny1992]] [[ny:User:Arseny1992]] [[oc:Utilizaire:Arseny1992]] [[om:User:Arseny1992]] [[or:User:Arseny1992]] [[os:Архайæг:Arseny1992]] [[pa:ਮੈਂਬਰ:Arseny1992]] [[pag:User:Arseny1992]] [[pam:User:Arseny1992]] [[pap:User:Arseny1992]] [[pdc:Benutzer:Arseny1992]] [[pi:User:Arseny1992]] [[pih:User:Arseny1992]] [[pl:Wikipedysta:Arseny1992]] [[pms:Utent:Arseny1992]] [[pnb:User:Arseny1992]] [[pnt:Χρήστες:Arseny1992]] [[ps:کارن:Arseny1992]] [[pt:Usuário:Arseny1992]] [[qu:Ruraq:Arseny1992]] [[rm:User:Arseny1992]] [[rmy:Jeno:Arseny1992]] [[rn:User:Arseny1992]] [[ro:Utilizator:Arseny1992]] [[roa-rup:User:Arseny1992]] [[roa-tara:User:Arseny1992]] [[ru:Участник:Arseny1992]] [[rw:User:Arseny1992]] [[sa:योजकः:Arseny1992]] [[sah:Кыттааччы:Arseny1992]] [[sc:Usuàriu:Arseny1992]] [[scn:Utenti:Arseny1992]] [[sco:User:Arseny1992]] [[sd:يوزر:Arseny1992]] [[se:User:Arseny1992]] [[sg:Utilisateur:Arseny1992]] [[sh:Korisnik:Arseny1992]] [[si:පරිශීලක:Arseny1992]] [[simple:User:Arseny1992]] [[sk:Redaktor:Arseny1992]] [[sl:Uporabnik:Arseny1992]] [[sm:User:Arseny1992]] [[sn:User:Arseny1992]] [[so:User:Arseny1992]] [[sq:Përdoruesi:Arseny1992]] [[sr:Корисник:Arseny1992]] [[srn:Masyin:Arseny1992]] [[ss:User:Arseny1992]] [[st:User:Arseny1992]] [[stq:Benutser:Arseny1992]] [[su:Pamaké:Arseny1992]] [[sv:Användare:Arseny1992]] [[sw:Mtumiaji:Arseny1992]] [[szl:Użytkownik:Arseny1992]] [[ta:பயனர்:Arseny1992]] [[te:వాడుకరి:Arseny1992]] [[tet:Uza-na'in:Arseny1992]] [[tg:Корбар:Arseny1992]] [[th:ผู้ใช้:Arseny1992]] [[ti:User:Arseny1992]] [[tk:Ulanyjy:Arseny1992]] [[tl:Tagagamit:Arseny1992]] [[tn:User:Arseny1992]] [[to:User:Arseny1992]] [[tpi:User:Arseny1992]] [[tr:Kullanıcı:Arseny1992]] [[ts:User:Arseny1992]] [[tt:Кулланучы:Arseny1992]] [[tum:User:Arseny1992]] [[tw:User:Arseny1992]] [[ty:Utilisateur:Arseny1992]] [[udm:Викиавтор:Arseny1992]] [[ug:User:Arseny1992]] [[uk:Користувач:Arseny1992]] [[ur:صارف:Arseny1992]] [[uz:Foydalanuvchi:Arseny1992]] [[ve:User:Arseny1992]] [[vec:Utente:Arseny1992]] [[vi:Thành viên:Arseny1992]] [[vls:Gebruker:Arseny1992]] [[vo:Geban:Arseny1992]] [[wa:Uzeu:Arseny1992]] [[war:User:Arseny1992]] [[wo:Jëfandikukat:Arseny1992]] [[wuu:用户:Arseny1992]] [[xal:Орлцач:Arseny1992]] [[xh:User:Arseny1992]] [[yi:באַניצער:Arseny1992]] [[yo:Oníṣe:Arseny1992]] [[za:用户:Arseny1992]] [[zea:Gebruker:Arseny1992]] [[zh-classical:User:Arseny1992]] [[zh-min-nan:User:Arseny1992]] [[zh-yue:User:Arseny1992]] [[zh:用户:Arseny1992]] [[zu:User:Arseny1992]] crswqgpicvh4pd0k7y8exe162ykbqge Gebruiker:Mav 2 2074 3828 2010-01-01T19:38:04Z Mav 450 Nuwe bladsy geskep met '[[meta:user:Mav]] (steward)' 3828 wikitext text/x-wiki [[meta:user:Mav]] (steward) hajh0mx2tpg4c15uco435wureq4bj5k Gebruiker:Vhorvat 2 2075 3830 2010-01-18T00:01:39Z Vhorvat 453 My page 3830 wikitext text/x-wiki {{Babel|color=yellow|hr|en-3|de-1|ru-1|it-1|-0}} [[:en:User:Vhorvat]] [[:hr:User:Vhorvat]] [[meta:User:Vhorvat]] 34akqpn6w7uihz3m72uy998z4txghwj Gebruiker:Jfblanc 2 2076 4658 4604 2013-05-14T13:49:06Z Jfblanc 470 4658 wikitext text/x-wiki {{#babel:{{CONTENTLANGUAGE}}-0|oc-4|bg-1|bs-2|ca-3|cs-3|csb-1|dsb-1|en-4|es-3|fr-N|hr-2|hsb-1|it-3|kg-1|la-2|pt-1|ro-1|ru-1|sc-1|sh-2|sk-2|sr-1|uk-1}} Joan Francés Blanc, username Jfblanc, sysop at the [http://oc.wikipedia.org Occitan wikipedia][[file:Flag of Occitania (with star).svg|20px]], with over 17,000 contributions since 2005, and over 30,000 to all the wikimedia projects since 2007. I had some Greek (ancient, and modern) when a student, but it's now so far away... <br />This wiki has '''{{NUMBEROFARTICLES}}''' articles. <br />[[File:Joan Francés Blanc (2013).png|120px]]<br />''Joan Francés Blanc''<br /> * [http://viaf.org/viaf/12524914/ Virtual International Authority File Record] g76csa7l899uxfl6gvgroakphjln0pk Gebruikerbespreking:Meno25 3 2080 3837 2010-01-24T04:32:23Z Meno25 91 talk 3837 wikitext text/x-wiki Please leave messages at [[w:en:User talk:Meno25]]. erhueog4jh9i02hvabsirfst0yl7g0j Gebruikerbespreking:Erwin 3 2081 4180 3838 2010-11-26T20:46:52Z Quentinv57 577 Softredirect 4180 wikitext text/x-wiki {{Softredirect|:m:User talk:Erwin}} n1ten5ghxndbhu5su4b2wp1d4xq8yq1 Gebruiker:Mercy/monobook.js 2 2082 6811 3839 2021-02-04T23:30:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6811 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Mercy/global.js&action=raw&ctype=text/javascript'); t69tpujqeggse5a8cq3oy84mk3fo7ba Gebruiker:Luckas Blade 2 2083 3840 2010-01-26T02:33:59Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested]]) 3840 wikitext text/x-wiki [[m:user:Luckas Blade]] shxv1fippnzra5i6sniv1ysrj98zrcq Gebruiker:Vinhtantran/monobook.js 2 2084 6824 3841 2021-02-04T23:32:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6824 javascript text/javascript mw.loader.load('https://vi.wikipedia.org/w/index.php?title=User:Vinhtantran/global.js&action=raw&ctype=text/javascript'); 5k8ee5rvlsvwbqlhmxr72yii7n4gv83 Gebruiker:Pmlineditor/monobook.js 2 2088 6814 3845 2021-02-04T23:30:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6814 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Pmlineditor/global.js&action=raw&ctype=text/javascript'); p4r59mrwk92ddahtq4z1re0n56sng2c Gebruiker:Prince Kassad 2 2089 3846 2010-01-29T02:26:34Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 3846 wikitext text/x-wiki [[m:wikt:User:Prince Kassad]] rp8pckki6ki5dfg9vnyis1kezq8bb71 Gebruiker:Kuvaly 2 2091 3848 2010-01-31T06:23:39Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 3848 wikitext text/x-wiki <div style="background:#1E90FF; border:2px solid #1E90FF; text-align:center;" width="100%"></div> <div style="font-family:Calibri, Myriad, 'Trebuchet MS', sans-serif; color:#1E90FF;">[[m:cs:Wikipedista:Kuvaly|cs.wiki]]</div> 08prlhwlqicacop3e00h7kmiu5qzymz Gebruiker:The Evil IP address/monobook.js 2 2092 6823 3849 2021-02-04T23:32:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6823 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:The_Evil_IP_address/global.js&action=raw&ctype=text/javascript'); sjepagp7h919t0akqrnmuleyix7w2s1 Gebruiker:The Evil IP address/monobook.css 2 2093 3850 2010-01-31T07:32:41Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 3850 css text/css importStylesheetURI('http://meta.wikimedia.org/w/index.php?title=User:The_Evil_IP_address/global.css&action=raw&ctype=text/css'); 150usgnfvma55vkokcc7ibotre5jowd Gebruiker:Phantomsteve 2 2094 3851 2010-02-01T21:38:47Z Phantomsteve 484 Create page 3851 wikitext text/x-wiki <div id="user-unified-login" style="font-size:85%; display:block; background:{{{background|#E0E8EF}}}; border:1px solid {{{border|#E0E8EF}}}; margin: 0.2em 0; padding:0.1em 0.3em; text-align:{{{align|left}}}; {{{extra-style|}}}">[[Special:MergeAccount/{{#titleparts:{{PAGENAME}}|1}}|Unified login]]: '''Phantomsteve''' is the unique login of this user for all public [[wmf:Main Page|Wikimedia]] [[wmf:Our projects|projects]]. </div> {|align=center |{{user af-0}} |{{user en}} |} ---- My huis wiki is die [[:w:|Engelse Wikipedia]], waar my gebruikers bladsy is [[:w:User:Phantomsteve|hier]]. Ek praat nie of nie gelees afrikaans. Jammer bxgqyxhxk9xv67cf57e00eipn9gwh0i Gebruikerbespreking:Phantomsteve 3 2095 3852 2010-02-01T21:39:11Z Phantomsteve 484 add language boxes 3852 wikitext text/x-wiki {|align=center |{{user af-0}} |{{user en}} |} ---- 6sgcalia1gmx409htg363g5lh2ky3e4 Gebruiker:Egmontaz/monobook.js 2 2099 6792 3857 2021-02-04T23:27:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6792 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Egmontaz/global.js&action=raw&ctype=text/javascript'); m9z3ro54csonshn6ic9nx4r7skgv2h7 Gebruiker:VasilievVV 2 2101 3861 2010-03-14T21:04:34Z VasilievVV 462 creating local userpage 3861 wikitext text/x-wiki <!-- This userpage was created using automatic script --> I am Victor Vasiliev, a member of [[m:SWMT|Small Wiki Monitoring Team]] and a [[m:Global sysops|global sysop]]. If you have questions regarding my actions, please use [[m:User talk:VasilievVV|my Meta talk page]]. 8zs5mw7wsuapn7naqscxqrptgqllwji Gebruiker:Romaine/monobook.js 2 2102 6784 4707 2021-01-31T11:28:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6784 javascript text/javascript mw.loader.load('//nl.wikipedia.org/w/index.php?title=User:Romaine/insertmonobook.js&action=raw&ctype=text/javascript'); pdtn0dfe16l4tvmykha5pm7o6d7uwr4 Gebruiker:Romaine/vector.js 2 2103 6785 4706 2021-01-31T11:28:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6785 javascript text/javascript mw.loader.load('//nl.wikipedia.org/w/index.php?title=User:Romaine/insertvector.js&action=raw&ctype=text/javascript'); jirhb557lbb9ewp3t9evb95hpam3ic5 Gebruiker:Romaine/vector.css 2 2104 4705 3866 2013-09-14T10:40:08Z Romaine 194 4705 css text/css @import url('//nl.wikipedia.org/w/index.php?title=User:Romaine/insertvector.css&action=raw&ctype=text/css'); 30fs6bpx2z5d970h4pf1ay25giwplg2 Gebruiker:BRUTE 2 2105 3867 2010-04-10T14:56:46Z BRUTE 487 Nuwe bladsy geskep met '*[[:m:User:BRUTE|My page on Meta]]' 3867 wikitext text/x-wiki *[[:m:User:BRUTE|My page on Meta]] jivau6ii68ey9e28w8etbgn9n51arud Gebruiker:Jyothis 2 2108 3870 2010-04-13T02:47:44Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 3870 wikitext text/x-wiki [[m:User:Jyothis|Jyothis]] r70beqyucymadx7223ftxqgrfs81une Wikibooks:Huidige gebeure 4 2109 3871 2010-04-19T14:30:32Z Pathoschild 29 Stuur aan na [[Wikibooks:Gebruikersportaal]] 3871 wikitext text/x-wiki #REDIRECT [[Wikibooks:Gebruikersportaal]] 31inol7rgolonzkh9tt0aw34bdlvcqf Die Engels taal/Les1 0 2112 7385 7384 2024-05-15T04:31:38Z Kwamikagami 2379 7385 wikitext text/x-wiki {| class="wikitable" |+ Nommers een tot honderd ! Afrikaans !! Engelse |- | een || one |- | twee || two |- | drie || three |- | vier || four |- | vyf || five |- | ses || six |- | sewe || seven |- | agt || eight |- | nege || nine |- | tien || ten |- | elf || eleven |- | twaalf || twelve |- | dertien || thirteen |- | veertien || fourteen |- | vyftien || fifteen |- | sestien || sixteen |- | sewentien || seventeen |- | agtien || eighteen |- | negentien || nineteen |- | twintig || twenty |- | dertig || thirty |- | veertig || forty |- | vyftig || fifty |- | sestig || sixty |- | sewentig || seventy |- | tagtig || eighty |- | negentig || ninety |- | een honderd || one hundred |} rgc3fbgock952iytkdawqnxm6b9r5ls Die Engels taal 0 2113 7272 7190 2023-08-09T09:16:34Z Kwamikagami 2379 860 kB 7272 wikitext text/x-wiki [[Beeld:Anglospeak (subnational version).svg|frameless|right]] <center><big><b>Die Engels taal</b></big></center> # [[Die Engels taal/Les1|Engels les een: nommers]] # [[Die Engels taal/Les2|Engels les twee: Vraag woorde]] [[Kategorie:Tale]] nrgdgg2anudb6ilt0tee62ewipop28m Boekrak:Natuurkunde 0 2114 6711 6706 2020-07-08T02:48:21Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6473 wikitext text/x-wiki '''Natuurkunde''' of '''[[w:fisika|fisika]]''' is 'n omvattende begrip van die algemene wetenskap van die natuur, wat die gedrag van materie en die heelal insluit. Boeke in hierdie vakgebied fokus op die natuurlike wetenskappe, aldus enige sistematiese kennis-gebaseerde óf voorskrywende praktyk wat daartoe in staat is om 'n voorspelling of voorspelbare uitkomste te lewer. Boeke vir onderwysers en leerders: * [[Hoërskool Natuur- en Skeikunde]] d66e1iwzah0xvasn1tacvqlyht2zaj5 Hoërskool Natuur- en Skeikunde 0 2115 6261 6260 2020-02-08T23:18:27Z Hasley 2021 Wysigings deur [[Special:Contributions/159.146.45.76|159.146.45.76]] teruggerol na laaste weergawe deur [[User:Hasley|Hasley]] 5698 wikitext text/x-wiki Die doel van ''Hoërskool Natuur- en Skeikunde'' is om die algemene wetenskappe vir sekondêre onderrig op 'n sistematiese en breedvoerige wyse te dek. Hierdie boek is gebaseer op die uitkomste van die Suid-Afrikaanse leerplan,<ref name="doe">http://www.thutong.doe.gov.za/Default.aspx?alias=www.thutong.doe.gov.za/physicalsciences. URL besoek op 2010-05-24</ref> met studie-eenhede vir Graad 10, 11 en 12. Elke studie-eenheid word onderverdeel in die onderskeie wetenskappe en onderwerpe. Die inhoud, soos hier bespreek, is nie daarop gerig om die amptelike Suid-Afrikaanse leerplan te vervang nie, dit dien bloot as 'n alternatiewe hulpmiddel vir die leerder en onderwyser. Daar moet self vasgestel word watter onderwerpe is van belang vir die leerplan. =Inhoudsopgawe= ==Eenheid 1: Graad 10== *'''<div style="font-size:120%;">[[/Deel 1-1: Meganika/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 1-2: Golwe, Klank en Lig/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 1-3: Elektrisiteit en Magnetisme/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 1-4: Materie en Materiale/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 1-5: Chemiese Verandering/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 1-6: Chemiese Sisteme/]]</div>''' ==Eenheid 2: Graad 11== *'''<div style="font-size:120%;">[[/Deel 2-1: Meganika/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 2-2: Golwe, Klank en Lig/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 2-3: Elektrisiteit en Magnetisme/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 2-4: Materie en Materiale/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 2-5: Chemiese Verandering/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 2-6: Chemiese Sisteme/]]</div>''' ==Eenheid 3: Graad 12== *'''<div style="font-size:120%;">[[/Deel 3-1: Meganika/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 3-2: Golwe, Klank en Lig/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 3-3: Elektrisiteit en Magnetisme/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 3-4: Materie en Materiale/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 3-5: Chemiese Verandering/]]</div>''' *'''<div style="font-size:120%;">[[/Deel 3-6: Chemiese Sisteme/]]</div>''' ==Bronne== <references /> [[Kategorie:Algemene Wetenskap]] [[Kategorie:Onderwys]] [[Kategorie:Boeke]] [[Kategorie:Natuurkunde]] [[Kategorie:Skeikunde]] hi3da1u7v34dez6ulej225dccbyea2t Hoërskool Natuur- en Skeikunde/Deel 1-1: Meganika 0 2116 6666 6615 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Minorax|Minorax]] 6482 wikitext text/x-wiki ==Beweging in Een Dimensie== ===Posisie, Verplasing, en Afstand=== ===Spoed en Snelheid=== ===Versnelling=== ===Diagramme en Vergelykings=== ===Verwysingsraamwerke=== ==Gravitasie en Meganiese Energie== ===Gewig=== ===Gravitasie Versnelling=== ===Gravitasie en Potensiële Energie=== ===Kinetiese Energie=== ===Meganiese Energie=== ===Behoud van Meganiese Energie=== 59w0al3bghx0445muj76ej4tll39abc Hoërskool Natuur- en Skeikunde/Deel 2-1: Meganika 0 2117 6660 6608 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6444 wikitext text/x-wiki ==Krag, Momentum en Impulse== ===Newton se Derde Wet=== ===Momentum=== ===Verandering in Momentum=== ==='n Impuls=== ===Newton se Tweede Wet=== ===Tasbare Kragte=== ===Nie-tasbare Kragte=== ===Newton se Gravitasiewet=== ===Kragmomente=== e9gvkfqux9i8aa8ojpzlxa4iu1eqep9 Hoërskool Natuur- en Skeikunde/Deel 3-1: Meganika 0 2118 6678 6587 2020-05-21T10:33:24Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6484 wikitext text/x-wiki ==Beweging in Twee Dimensies== Hierdie hoofstuk handel oor die vertikale projektielbeweging asook beweging in twee dimensies. Die behoud van momentum in twee dimensies sal ook ondersoek word. ===Projektielbeweging=== Voorheen is daar gekyk na die beweging van voorwerpe wat vryval, en waargeneem dat so 'n voorwerp onderworpe is aan gravitasieversnelling, ''g''. In hierdie afdeling gaan die beweging van voorwerpe wat in die lug opwaarts gegooi, en dan terugval aarde toe, bestudeer word. Laasgenoemde tipe beweging word '''''projektielbeweging''''' genoem, en vir hierdie waarneming sal daar net gekyk word na voorwerpe wat loodreg opwaarts en terug afwaarts beweeg, dus geen horisontale verplasing van die voorwerp word waargeneem nie, slegs die vertikale verplasing. ====Beweging in 'n Gravitasieveld==== Wanneer 'n voorwerp in 'n gravitasieveld beweeg, sal die voorwerp altyd afwaarts versnel met 'n konstante versnelling ''g'', ongeag die voorwerp se beweging opwaarts of afwaarts. [[lêer:Beweging in gravistasieveld met teks.png|thumb|centre|500px|Voorwerpe wat op- of afwaarts beweeg sal altyd afwaarts versnel in 'n gravitasieveld.]] </br > Dit beteken dat, indien die voorwerp opwaarts beweeg, sal die snelheid daarvan verminder tot dit stop (''v<sub>f</sub> = 0 m.s<sup>-1</sup>''). Dit is dan die maksimum hoogte wat so 'n voorwerp kan bereik, en na daardie oomblik sal die begin terugval na die aarde. [[lêer:Beweging in gravistasieveld - op en af met teks.png|thumb|centre|500px|(a) 'n Voorwerp word opwaarts gegooi vanaf 'n hoogte ''h<sub>0</sub>''. (b) Na 'n sekere tydsverloop ''t<sub>m</sub>'' bereik die voorwerp 'n maksimum hoogte en begin dan terugval Aarde toe. (c) Na 'n tyd 2 × ''t<sub>m</sub>'' bereik die voorwerp weer die oorspronklike hoogte by ''h<sub>0</sub>''.]] </br > Beskou 'n voorwerp wat opwaarts gegooi word vanaf 'n vertikale hoogte ''h<sub>0</sub>''. Daar kan waargeneem word hoe die voorwerp opwaarts beweeg met 'n afnemende snelheid tot dit vir 'n oomblik stop, die voorwerp se maksimum hoogte, en dan daarna begin val. Die tyd wat dit vir die voorwerp neem om weer afwaarts terug te val na hoogte ''h<sub>0</sub>'' is dieselfde as die tyd wat dit die voorwerp geneem het om die maksimum hoogte vanaf ''h<sub>0</sub>'' te bereik. ====Bewegingsvergelykings==== Voorheen is die bewegingsvergelykings gebruik vir die verduideliking van 'n voorwerp in vryval. Hierdie vergelykings kan ook gebruik word vir projektielbeweging. Dit is eenders aan die bewegingsvergelykings wat voorheen afgelei is, maar met ''a = g''. Vervolgens sal ''g = 9,8 m.s<sup>-2</sup>'' vir berekeninge gebruik word. <br /> :<math>v_i</math> = beginsnelheid (''m.s<sup>-1</sup>'') by tyd ''t = 0 ''<br /> :<math>v_f</math> = eindsnelheid (''m.s<sup>-1</sup>'') by tyd ''t''<br /> :<math>\Delta x </math> = hoogte bokant die grondoppervlak (''m'')<br /> :<math>t</math> = tyd (''s'')<br /> :<math>\Delta t </math> = tydinterval (''s'')<br /> :<math>g </math> = gravitasieversnelling (''m.s<sup>-2</sup>'')<br /> <br /> :<math>v_f = v_i + gt\,\!</math><br /> :<math>\Delta x = \frac{(v_i + v_f)}{2} t</math><br /> :<math>\Delta x = v_it + \frac{1}{2}gt^2 </math><br /> :<math>v_f^2 = v_i^2 + 2g\Delta x </math><br /> <br /> ====Grafieke van Vertikale Projektielbeweging==== Vertikale projektielbeweging is eenders aan beweging teen 'n konstante versnelling, wat reeds voorheen bespreek is. Die grafieke vir vertikale projektielbeweging is daarom identies aan aan die grafieke van beweging onderhewig aan konstante versnelling. Wanneer die grafieke vir vertikale projektielbeweging geteken word, moet daar twee gevalle in gedagte gehou word: die voorwerp wat opwaarts beweeg en dan dieselfde voorwerp wat daarna van rigting verander en afwaarts beweeg. Indien die opwaartse rigting positief gekies word, kan die grafieke gevolglik die verandering van verplasing, snelheid en versnelling aandui. [[Lêer:Grafieke - vertikale projektielbeweging.png|thumb|right|500px| Hierdie grafieke toon die (a) verplasing, (b) snelheid en (c) versnelling van 'n voorwerp wat opwaarts gegooi word teenoor tyd. Die voorwerp word opwaarts gegooi met 'n beginsnelheid van ''v<sub>i</sub>''. Dit neem die voorwerp 'n tyd van ''t<sub>m</sub>'' om die maksimum hoogte ''h<sub>m</sub>'' te bereik, en dan terug te val na die grond toe. Let op hoe die versnelling konstant en negatief bly gedurende die voorwerp se beweging.]] ''Verandering in verplasing''</br > In hierdie geval vorm die grafiek van verplasing teenoor tyd 'n onderstebo “U” waar die verplasing by 'n hoogte gelyk aan nul begin (''h<sub>0</sub> = 0''). Soos die voorwerp opwaarts beweeg neem die verandering van hoogte teenoor tyd af, totdat die kurwe afplat, waar die voorwerp se snelheid gelyk is aan nul, en die maksimum hoogte (''h = h<sub>m</sub>'') bereik is wat ook ooreenstem met die tyd van maksimum hoogte (''t<sub>m</sub>''). Vandaar beweeg die voorwerp afwaarts tot dit weer die oorspronklike hoogte, ''h<sub>0</sub> = 0'' bereik, wat ooreenstem met die tyd ''t<sub>f</sub>''. ''Verandering in snelheid''</br > Met die verandering in snelheid teenoor tyd is dit belangrik om daarop te let dat: # Die opwaartse snelheid was gekies as positief, # Die voorwerp begin met 'n positiewe snelheid êrens op die y-as (''v<sub>i</sub>''), # Die voorwerp se snelheid neem af tot dit nul bereik teenoor die maksimum hoogte daarvan (''v = 0'' by ''h<sub>m</sub>'' en ''t<sub>m</sub>''), # Die voorwerp beweeg dan in die teenoorgestelde rigting, daarom 'n negatiewe snelheid, tot dit die grond bereik met ''v<sub>f</sub>'' by ''t<sub>f</sub>''. ''Verandering in versnelling''</br > Soos wat die voorwerp beweeg is ''a = g'', met die opwaartse rigting gekies as positief. Omdat die gravitasieversnelling van die aarde afwaarts is en nie verander nie, sal die versnelling van die voorwerp regdeur die beweging daarvan konstant en negatief bly. ===Behoud van Momentum in Twee Dimensies=== Daar is voorheen bespreek dat momentum in 'n spesifieke sisteem bewaar word indien daar nie ander eksterne kragte bestaan wat op daardie sisteem inwerk nie. In teenstelling daarmee, 'n eksterne krag veroorsaak 'n verandering in momentum, oftewel ''Δp'', met 'n impuls vanaf 'n krag wat daarop inwerk, ''F'' vir 'n tyd ''Δt'' soos gegee deur: :<math>\Delta p = F \cdot \Delta t</math></br > Dieselfde beginsels vir die bewaring van momentum in een dimensie soos gestudeer geld vir toepassings van probleme vir die bewaring van momentum in twee dimensies. Die berekening van momentum in twee dimensies is dieselfde as vir een dimensie. Vir die berekeninge in twee dimensies word die momentum opgebreek in die momentum se ''x''- en ''y''-as komponente. Die beginsel van die behoud van momentum word dan toegepas op die onderskeie komponente. Beskou twee bewegende voorwerpe wat na mekaar beweeg. Die situasie kan geanaliseer word deur die ''x'' en ''y''-komponente van elkeen se momentum te bereken. [[Lêer:Behoud van momentum in 2D - voor.png|thumb|center|300px|Totale momentum van die sisteem '''voor''' die botsing.]] </br > ''Voor die botsing''</br > Totale momentum: :<math> p_{i1} = m_1 v_{i1}</math> :<math> p_{i2} = m_2 v_{i2}</math> ''x''-komponent van die momentum: :<math> p_{i1x} = m_1 v_{i1x} = m_1 v_{i1} \cos \theta_1</math> :<math> p_{i2x} = m_2 u_{i2x} = m_2 v_{i2} \sin \theta_2</math> ''y''-komponent van die momentum: :<math> p_{i1y} = m_1 v_{i1y} = m_1 v_{i1} \cos \theta_1</math> :<math> p_{i2y} = m_2 v_{i2y} = m_2 v_{i2} \sin \theta_2</math></br > </br > [[Lêer:Behoud van momentum in 2D - na.png|thumb|center|300px|Totale momentum van die sisteem '''na''' die botsing.]] ''Na die botsing''</br > Totale momentum: :<math> p_{f1} = m_1 v_{f1}</math> :<math> p_{f2} = m_2 v_{f2}</math> ''x''-komponent van die momentum: :<math> p_{f1x} = m_1 v_{f1x} = m_1 v_{f1} \cos \phi_1</math> :<math> p_{f2x} = m_2 v_{f2x} = m_2 v_{f2} \sin \phi_2</math> ''y''-komponent van die momentum: :<math> p_{f1y} = m_1 v_{f1y} = m_1 v_{f1} \cos \phi_1</math> :<math> p_{f2y} = m_2 v_{f2y} = m_2 v_{f2} \sin \phi_2</math></br > ''Behoud van momentum''</br > Die aanvanklike momentum is gelyk aan die eindmomentum: :<math> p_{i}=p_{f}</math> :<math> p_{i} = p_{i1}+p_{i2}</math> :<math> p_{f} = p_{f1}+p_{f2}</math> </br > Die bostaande vorm die basis van enige momentum analise en die behoud van momentum in twee dimensies. ====Tipes Botsings==== Daar bestaan twee tipes botsings wat van toepassing op momentumbehoud is: * elastiese botsings, en * onelastiese botsings. Vir beide tipes botsings sal die totale momentum ''altyd'' behoue bly. Kinetiese energie word bewaar in elastiese botsings, maar nie vir onelastiese botsings nie. =====Elastiese Botsings===== :'''Definisie van elastiese botsings:''' 'n elastiese botsing is 'n botsing waar die '''totale momentum''' en '''totale kinetiese energie''' behoue bly. Die bostaande definisie beteken dat vir 'n elastiese botsing die totale momentum ''en'' totale kinetiese energie voor die botsing ''dieselfde'' sal wees as na die botsing. Vir hierdie tipe botsings sal die kinetiese energie nie verander na 'n ander tipe energie nie. [[Lêer:Elastiese momentum - voor.png|thumb|center|400px|Twee voorwerpe '''voor''' hulle bots.]] ''Voor die botsing''</br > Voor twee voorwerpe bots is die totale momentum van die stelsel gelyk aan die som van die individuele momentums. </br > Gestel voorwerp 1 het 'n momentum van ''p<sub>i1</sub>'' en voorwerp 2 het 'n momentum van ''p<sub>i2</sub>'', sal dit beteken dat die totale momentum voor botsing: :<math>p_{i} = p_{i1}+ p_{i2}</math> Die kinetiese energie kan op dieselfde wyse bereken word. Voorwerp 1 het 'n kinetiese energie gelyk aan ''KE<sub>i1</sub>'' en voorwerp 2 het 'n kinetiese energie gelyk aan ''KE<sub>i2</sub>''. Dit beteken die totale kinetiese energie voor die botsing is: :<math>KE_i = KE_{i1} + KE_{i2}</math> </br > [[Lêer:Elastiese momentum - na.png|thumb|center|300px|Twee voorwerpe '''nadat''' hulle gebots het.]] ''Na die botsing''</br > Na die botsing bons die twee voorwerpe weg van mekaar af; albei besit nuwe momentums en nuwe kinetiese energieë. Soos voorheen is die totale momentum van die sisteem gelyk aan die som van al die individuele momentums. </br > Voorwerp 1 besit nou 'n momentum ''p<sub>f1</sub>'' en voorwerp 2 besit 'n momentum ''p<sub>f2</sub>''. Dit beteken dus dat die totale momentum na die botsing is: :<math>p_{f} = p_{f1}+ p_{f2}</math> Voorwerp 1 het nou 'n kinetiese energie gelyk aan ''KE<sub>f1</sub>'' en voorwerp 2 se kinetiese energie is ''KE<sub>f2</sub>'', wat dus maak dat die totale kinetiese energie na die botsing is: :<math>KE_f = KE_{f1} + KE_{f2}</math> Omdat hierdie botsing 'n ''elastiese'' botsing is, is die totale momentum voor die botsing gelyk aan die totale momentum na die botsing '''en''' die totale kinetiese energie voor die botsing is gelyk aan die totale kinetiese energie na die botsing, wat dus maak dat: :<math>Begin = Einde</math> :<math>p_i = p_f</math> :<math>p_{i1}+ p_{i2} = p_{f1}+ p_{f2}</math></br > :'''en''' :<math>KE_i = KE_f</math> :<math>KE_{i1} + KE_{i2} = KE_{f1} + KE_{f2}</math> =====Nie-elastiese Botsings===== :'''Definisie van nie-elastiese botsings:''' 'n nie-elastiese botsing is 'n botsing waar die '''totale momentum''' en '''totale kinetiese energie''' ''nie'' behoue bly ''nie''. Die kinetiese energie word ''omgeskakel'' na ander vorme van energie. Die totale momentum voor 'n nie-elastiese botsing bly dieselfde na die botsing, maar die totale ''kinetiese'' energie voor en na die onelastiese botsing is ''verskillend''. Dit beteken egter nie dat die totale energie bewaar word nie, maar eerder dat die energie ''omgeskakel'' word na 'n ander tipe energie. 'n Duimreël vir wanneer nie-elastiese botsings plaasvind is dat die botsende op 'n sekere wyse voorwerpe vervorm. Gewoonlik verander die vorm van so 'n voorwerp. Die verandering van die voorwerp se vorm verg energie en dit is waarheen die “vermiste” kinetiese energie verdwyn het. 'n Klassieke voorbeeld van 'n nie-elastiese botsing is 'n motorvoertuigongeluk. Die motors verander van vorm tydens 'n botsing, en daar is 'n waarneembare verandering in die kinetiese energie van die motors voor en na die botsing. Die energie was gebruik om die metaal te buig en die bakwerk te vervorm. [[Lêer:Nie-elastiese momentum - voor.png|thumb|right|300px|'n Asteroïde wat na die Maan beweeg - voor die botsing.]] Gestel die voorbeeld van 'n asteroïde wat na die Maan beweeg word gebruik. Voor die asteroide teen die Maan bots is die totale momentum van die stelsel: :<math>p_{i} = p_{im}+ p_{ia}</math></br > Die totale kinetiese energie van die stelsel is: :<math>KE_i = KE_{im} + KE_{ia}</math></br > </br > [[Lêer:Nie-elastiese momentum - na.png|thumb|right|200px|Die asteroïde het met die Maan gebots en 'n krater gevorm.]] Wanneer die asteroïde onelasties bots teen die Maan, sal die kinetiese energie daarvan omgeskakel word na meestal hitte-energie. Indien die hitte-energie groot genoeg is, kan dit veroorsaak dat die asteroïde en gebied wat die asteroïde op die Maan se oppervlak tref begin smelt! Vanaf die krag van die asteroïde se impak kan die gesmelte rots uitwaarts vloei en 'n krater op die Maan vorm. Na die botsing is die totale momentum van die stelsel dieselfde soos voorheen, maar omdat die botsing ''onelasties'' is (wat waargeneem word deur die verandering van die voorwerpe se vorm), is die kinetiese energie '''nie''' dieselfde as voor die botsing '''nie'''. Momentum bly behoue: :<math>p_i = p_f</math> Maar die totale kinetiese energie van die stelsel bly nie behoue nie: :<math>KE_i \ne KE_f</math> ====Hoë Energie Botsings==== ===Verwysingsraamwerke=== ====Inleiding==== [[Lêer:Verwysingsraamwerke 01 met teks.png|thumb|right|400px|'n Illustrasie van 'n motor wat van Oos na Wes beweeg. Persoon A is Suid van die pad, en B Noord.]] Verwysingsraamwerke kan geïllustreer word deur die voorbeeld van 'n motor wat van Oos van Wes beweeg, en twee persone A en B wat onderskeidelik Suid en Noord van die aankomende motor staan. Vir die B wat na die Suide kyk beweeg die motor na regs, maar vir persoon A wat na die Noorde kyk, beweeg die motor na links. Hierdie verskil van die persone se sienings aangaande die beweging van die motor word veroorsaak deur elkeen se unieke ''verwysingsraamwerk'' met betrekking tot die stelsel. Indien elke persoon gevra sou word in watter rigting die motor beweeg, sou elkeen 'n verskillende antwoord gee. Die antwoord sou relatief tot elkeen se verwysingsraamwerk wees. ====Wat is 'n Verwysingsraamwerk?==== :'''Definisie van 'n verwysingsraamwerk:''' 'n ''verwysingsraamwerk'' is die spesifieke oogpunt waaruit 'n stelsel waargeneem word. Prakties gesproke is 'n verwysingsraamwerk 'n stel asse (wat rigtings spesifiseer) met 'n oorsprong. 'n Waarnemer kan dan die posisie en beweging van alle punte in 'n stelsel peil, asook die oriëntasie van voorwerpe in die stelsel relatief tot die verwysingsraamwerk. Daar bestaan twee tipes verwysingsraamwerke: traagheid en nie-traagheid. 'n Traagheidsverwyssingsraamwerk beweeg teen 'n konstante snelheid, wat beteken dat Newton se Eerste Wet (traagheid) waar is. 'n Nie-traagheidsverwysingsraamwerk, soos 'n bewegende motor of 'n roterende mallemeule, versnel. Daarom is Newton se Eerste Wet nie waar vir nie-traagheidsverwysingsraamwerke nie, soos voorwerpe wat skynbaar versnel sonder die gepaste kragte wat daarop inwerk. ====Waarom is Verwysingsraamwerke Belangrik?==== Verwysingsraamwerke is belangrik omdat, soos daar in die inleiding se voorbeeld geïllustreer is, die snelheid van 'n voorwerp kan verskil vanweë die verwysingsraamwerk wat gebruik word. :''Uitbreiding van die onderwerp:'' :Verwysingsraamwerke is veral van belang in spesiale relatiwiteit - indien só 'n verwysingsraamwerk teen 'n beduidende breukdeel van die spoed van lig beweeg, sal die verloop van tyd nie noodwendig van toepassing wees op ander verwysingsraamwerke nie. Die spoed van lig word beskou as die enigste werklike konstante tussen verwysingsraamwerke. ====Relatiewe Snelheid==== Die snelheid van 'n voorwerp is raamwerk-afhanklik. Meer spesifiek, die waargenome snelheid van 'n voorwerp is afhanklik van die snelheid van die waarnemer. Byvoorbeeld, 'n persoon wat op die strand staan en die snelheid van 'n boot in die water waarneem sal verskillend wees van die waarneming van 'n passasier op dieselfde boot. ==Werk, Krag en Energie== ===Inleiding=== Gestel 'n straatverkoper dra 'n mandjie vol vrugte op haar kop. Doen sy enige ''werk''? Oënskynlik sal sy werk doen, maar in Fisika is dit nie die geval nie! Weereens, gestel 'n seun wat teen 'n muur stoot. Is hy besig om enige werk te doen? Daar sal waarskynlik waargeneem word hoe sy spiere saamtrek, en hy mag selfs sweet. Maar in Fisika doen die seun geen werk nie! Indien die straatverkoper die mandjie vir 'n baie lang afstand dra mag daar dalk 'n opmerking gemaak word dat sy baie ''energie'' het, wat beteken dat sy baie stamina besit. Indien 'n motor baie vinnig beweeg kan dit beskryf word as baie kragtig, oftewel dit besit baie ''drywing''. Dus is daar 'n verband tussen spoed en drywing. In Fisika beteken ''drywing'' egter iets anders. Hierdie hoofstuk beskryf die verband tussen ''werk'', ''energie'' en ''drywing''. Werk en energie is verwant aan mekaar. Die energie van 'n voorwerp is die kapasiteit daarvan om werk te verrig, en om werk te verrig is die proses van energie-omskakeling vanaf een vorm na 'n ander. Met ander woorde, *'n voorwerp met baie energie kan baie werk doen, en *wanneer werk gedoen word, word energie verloor deur die voorwerp wat die werk verrig en opgeneem deur die voorwerp waarop die werk gedoen word. Deur 'n voorwerp op te tel of te gooi vereis dat werk gedoen moet word — werk word op die voorwerp gedoen. Selfs met die opwekking van elektrisiteit vereis dat 'n vorm van werk verrig moet word. Iets moet energie besit en dit oordra deur werk te doen sodat dinge kan gebeur. ===Werk en Krag=== :'''Definisie van werk''': wanneer 'n krag op 'n voorwerp uitgeoefen word, en dit die voorwerp laat beweeg, word werk gedoen op die voorwerp, tensy die krag en verplasing loodreg is teenoor mekaar. [[Lêer:Krag F teen cos theta.png|thumb|center|200px|Die krag ''F'' veroorsaak dat die voorwerp met 'n afstand ''Δx'' verplaas word teen 'n hoek ''θ''.]] Dit beteken dat om werk te doen, moet 'n voorwerp 'n afstand ''d'' beweeg met 'n krag ''F'' wat daarop inwerk, op só 'n wyse dat daar 'n nie-nul komponent van die krag bestaan in die rigting van die verplasing. Werk word dan bereken as: :<math>W = F \cdot \Delta x \cos \theta </math> waar :''F'' die toegepaste krag is, :''Δx'' is die verplasing van die voorwerp, en :''θ'' is die hoek tussen die toegepaste krag en die rigting van die beweging. Dit is baie belangrik om daarop te let dat vir werk wat gedoen word daar 'n komponent van die krag in die rigting van die beweging moet wees. Kragte loodreg tot die rigting van beweging doen nie werk nie. [[Lêer:Krag teen rigting van verplasing.png|thumb|center|400px|(a) Die krag ''F'' veroorsaak dat die voorwerp verplaas word met ''Δx'' in dieselfde rigting van die krag. ''θ'' = 180° en ''cosθ'' = 1. Werk word wel hier gedoen. (b) 'n Krag ''F'' werk in op 'n voorwerp. Die voorwerp word verplaas met ''Δy'' loodreg teen die krag. ''θ'' = 90° en ''cosθ'' = 0. Werk word egter nie hier gedoen nie.]] :'''Belangrik:''' Die betekenis van ''θ'' is die hoek tussen die krag vektor en die veplasingsvektor. Vir die volgende gevalle is ''θ = 0°'': [[Lêer:Krag en verplasing - theta gelyk aan nul.png|thumb|center|450px]] Soos met alle fisiese mates moet werk eenhede hê. Soos vanuit die definisie van werk word dit gemeet in ''N·m''. Die naam wat vir hierdie kombinasie van SI-eenhede gegee word is die joule (simbool: ''J''). :'''Definisie van joule''': 1 joule is die werk wat verrig word wanneer 'n voorwerp 1 meter beweeg met 'n krag gelykstaande aan 1 newton wat daarop inwerk, in die rigting van die beweging. Die werk wat deur 'n voorwerp gedoen word kan positief of negatief wees. Sedert die krag (''F'') en verplasing (''s'') albei vektore is, is die uitslag van die bogenoemde vergelyking afhanklik van die rigtings: *Indien ''F'' in dieselfde rigting as die beweging inwerk sal positiewe werk gedoen word. In hierdie geval sal die voorwerp waarop die krag inwerk se energie toeneem. *Indien die beweging en ''F'' se rigtings teenoorgesteld is, sal negatiewe werk gedoen word. Dit beteken energie word oorgedra in die teenoorgestelde rigting. Byvoorbeeld, indien 'n motor opwaarts teen 'n heuwel gestoot word deur 'n krag opwaarts, maar die motor beweeg afwaarts word daar negatiewe werk op die motor gedoen. Die teenoorgestelde daarvan is dat die motor positiewe werk op die persoon doen. ===Werk en Meganiese Energie=== ====Eksterne en Interne Kragte==== In die Graad 10 sillabus was die behoud van meganiese energie ondersoek – meganiese energie bly behoue in die afwesigheid van eksterne kragte. Dit is belangrik om te weet of 'n krag intern of ekstern is, omdat dit bepaal of 'n krag die vermoeë beskik om 'n voorwerp se totale meganiese energie te beïnvloed wanneer daar werk op die voorwerp gedoen word.</br > Wanneer 'n eksterne krag (soos wrywing, lugweerstand, en kragte wat op 'n voorwerp inwerk) op 'n voorwerp inwerk sal die totale meganiese energie (die kinetiese energie en die potensiële energie) van die voorwerp verander. Indien positiewe werk verrig word, sal die voorwerp energie wen. Indien negatiewe werk verrig word, sal die voorwerp energie verloor. Die wins of verlies van energie kan in die vorm van kinetiese of potensiële energie, of albei, geskied. Die werk wat egter gedoen word is gelyk aan die verandering van die voorwerp se meganiese energie.</br > Wanneer 'n interne krag op 'n voorwerp inwerk (soos gravitasie- en veerkragte), sal die totale meganiese energie (die kinetiese en potensiële energie) van die voorwerp konstant bly, maar die voorwerp se energie kan van vorm verander. ===Drywing=== 1y67jjiapdg69ub4eatc4qboa9hlmw1 Hoërskool Natuur- en Skeikunde/Deel 1-2: Golwe, Klank en Lig 0 2119 6483 6409 2020-02-12T18:25:14Z Meiræ 1408 Rol weergawe 6409 deur [[Special:Contributions/159.146.18.89|159.146.18.89]] ([[User talk:159.146.18.89|bespreek]]) terug. 6483 wikitext text/x-wiki ==Transversale Pulse== ===Pulslengte, Amplitude en Spoed=== ===Pulsgrafieke=== ====Posisie==== ====Verplasing==== ====Snelheid==== ====Versnelling==== ===Pulsgeleiding, en Pulsrefleksie=== ===Pulsmediums=== ===Vaste en Oop Ente=== ===Superposisie=== ==Transversale Golwe== ===Golflengte, Frekwensie, Amplitude, Periode en Spoed=== <ref></ref>===Deeltjie Posisie, Verplasing, Snelheid en Versnelling=== v=fʎ ===Staande Golwe met Grense=== ===Superposisie=== ==Geometriese Optika== ===Liggolwe=== ===Weerkaatsing=== ===Weerkaatsing in Verskillende Mediums=== ===Spieëls=== ===Totale Interne Weerkaatsing=== 55xaz4cdf90qump1b5p8fvdkr98c1tq Hoërskool Natuur- en Skeikunde/Deel 2-2: Golwe, Klank en Lig 0 2120 4673 4655 2013-06-21T04:10:53Z 41.13.64.193 /* Gravitasie Lense */ 4673 wikitext text/x-wiki ==Geometriese Optika== ===Lense en Beelde=== ====Gravitasie Lense==== ====Brille==== ====Die Oog==== ===Teleskope=== ===Mikroskope=== ==Longitudinale Golwe== ===Golflengte, Frekwensie, Amplitude, Periode en Spoed=== ===Deeltjie Posisie, Verplasing, Snelheid en Versnelling=== ===Klankgolwe=== ==Klank== ===Toonhoogte, Luidheid en Kwaliteit=== ===Die Oor en Gehoor=== ===Ultraklank=== ==Die Wetenskap van Musiek== ===Staande Golwe in Verskillende Instrumente=== jhj6gp40bgin0x1g6kfqlpbz4jibwcd Hoërskool Natuur- en Skeikunde/Deel 3-2: Golwe, Klank en Lig 0 2121 6750 6744 2020-07-08T02:52:52Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Hamish|Hamish]] 4049 wikitext text/x-wiki ==Die Doppler Effek== ===Klank en Ultraklank=== ===Lig=== ==Kleur== ===Die Verband tussen Golflengte en Frekwensie=== ===Pigmente en Verwe=== ==Twee- en Drie Dimensionele Golffronte== ===Diffraksie=== ===Interferensie=== ===Skokgolwe en Supersoniese Knal=== ==Klankeienskap van Materie== ===Die De Broglie Golflengte=== ===Elektronmikroskoop=== 07ehhh3i0k951r4jkolwol80q64ydot Hoërskool Natuur- en Skeikunde/Deel 1-3: Elektrisiteit en Magnetisme 0 2122 6662 6623 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:178.243.78.42|178.243.78.42]] 6553 wikitext text/x-wiki lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości. ==Magnetisme== ===Magneetvelde en Permanente Magnete=== ===Magneetpole, Aantrekking en Afstoting=== ===Die Aarde se Magneetveld=== ==Elektrostatika== ===Twee Soorte Ladings=== ===Kragte tussen Ladings=== ===Aantrekking tussen Gelaaide en Nie-gelaaide Voorwerpe=== ===Geleiers en Isolators=== ==Elektriese Stroombane== ===Geslote en Oop Stroombane=== ===Elektriese Potensiaalverskil=== ===Elektriese Stroom=== ===Elektriese Weerstand=== ===Beginsels en Instrumente van Elektriese Metings=== 5s76tzdovb7ev8zg0lolw2in9jbljtr Hoërskool Natuur- en Skeikunde/Deel 2-3: Elektrisiteit en Magnetisme 0 2123 6677 6589 2020-05-21T10:33:18Z Sakretsu 2179 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Hasley|Hasley]] 5718 wikitext text/x-wiki ==Elektrostatika== ===Kragte tussen Ladings=== ===Elektriese Velde=== ===Elektriese Potensiële Energie en Potensiaalverskil=== ===Kapasitansie en Kapasitore=== ===Kapasitors in 'n Elektriese Stroombaan=== ==Elektromagnetisme== ==='n Magnetiese Veld en Elektriese Stroom=== ===Geïnduseerde Elektriese Stroom=== ===Transformators=== ===Beweging van 'n Enkeldeeltjie in 'n Magnetiese Veld=== ==Elektriese Stroombane== ===Ohm se Wet=== ===Verskillende Weerstande=== ===Series en Parallelle Netwerke=== ==='n Wheatstone Brug=== hhomd5eyduuw583df6txw4sq1pprv8k Hoërskool Natuur- en Skeikunde/Deel 3-3: Elektrisiteit en Magnetisme 0 2124 6658 6649 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6494 wikitext text/x-wiki ==Elektrodinamika== ===Elektriese Masjiene=== ====Generators==== ====Elektriese Motors==== ===Wisselstroom=== ===Kapasitansie en Induktansie=== ==Elektronika== ===Kapasiewe en Induktiewe Elektriese Stroombane=== ===Filters en Seinstemming=== ===Elektriese Stroombaan Elemente=== ===Beginsels van Digitale Elektronika=== ==Elektromagnetiese Straling== ===Deeltjie-eienskap van Elektromagnetiese Straling=== ===Eienskappe van Elektromagnetiese Straling=== ===Elektromagnetiese Spektrum=== ===Deeltjie-eienskap van Elektromagnetisme=== ===Penetrasie Vermoë=== mihmb059tsfxr8myve9ceet8koisk8n Hoërskool Natuur- en Skeikunde/Deel 2-4: Materie en Materiale 0 2125 6505 6504 2020-02-29T04:35:49Z Minorax 2092 revert edits by [[Special:Contributions/178.240.197.141|178.240.197.141]] 6505 wikitext text/x-wiki ==Elektroniese Eienskappe van Materie== ===Geleiding in Halfgeleiers, Metale en Ioniese Vloeistowwe=== ===Intrinsieke Eienskappe van Materie=== ===Beginsels van die P-N Verbinding en 'n Diode=== ===Isolators en Stroombaanbrekers=== ==Atomiese Kombinasies: Molekulêre Struktuur== ===Chemiese Bindings=== ===Chemiese Bindings en Lewis Teorie=== ===Elektronegatiwiteit van Atome en Polarisasie=== ===Oksidasiegetalle van Atome=== ===Bindingsenergieë en -lengtes=== ===Veelvoudige Bindings=== ===Molekulêre Vorms=== ==Atoomkerns== ===Atoomstruktuur en Stabiliteit=== ===Radioaktiwiteit=== ===Straling en Ionisasie=== ===Kernsplyting en Fusie=== ===Kernsintese=== ===Beraming van die Aarde se Ouderdom=== ==Ideale Gasse en Termiese Eienskappe== ===Beweging van Deeltjies=== ===Kinetiese Teorie van Gasse=== ===Temperatuur, Verhitting en Druk=== ===Die Ideale Gaswet=== q91ajk1q28f6nfdfnxi8o3chm1hvqf8 Hoërskool Natuur- en Skeikunde/Deel 1-4: Materie en Materiale 0 2126 6066 5997 2020-01-08T21:34:10Z ~riley 993 Wysigings deur [[Special:Contributions/178.243.20.235|178.243.20.235]] teruggerol na laaste weergawe deur [[User:Minorax|Minorax]] 5695 wikitext text/x-wiki ==Makroskopiese Oorsig van Materiale== ===Die Samestelling van 'n Voorwerp=== ===Mengsels=== ====Homogene Mengsels==== ====Heterogene Mengsels==== ===Suiwer Stowwe=== ====Elemente==== ====Verbindings (of Samestellings)==== ===Name van Formules en Stowwe=== ===Metale, Halfmetale en Nie-metale=== ===Elektriese Geleiers, Halfgeleiers en Isolators=== ===Termiese Geleiers en Isolators=== ===Magnetiese en Nie-Magnetiese Materiale=== ==Oorsig van Deeltjie-stowwe== ===Atome en Molekules=== ===Makroskopiese Eienskappe en Mikrostruktuur van Materiale=== ===Molekulêre Kragte=== ==Die Atoom== ===Modelle van die Atoom=== ===Atoommassa en Deursnee=== ===Atoomstruktuur=== ===Isotope=== ===Elektronkonfigurasie=== ===Ionisasie Energieë=== lpwrwalamr6r6c635k3bdlv0gs4aya8 Die Engels taal/Les2 0 2127 7381 7195 2024-05-15T04:20:19Z Kwamikagami 2379 7381 wikitext text/x-wiki {| class="wikitable" |+ Vraag woorde ! Afrikaans !! Engelse |- | wie || who |- | wie se / wat se || whose |- | waar || where |- | hoe || how |- | wat || what |- | hoekom/waarom || why |- | wanneer || when |- | watter || which |- | hoeveel || how much / how many |} 6znrw6o8jhae8h0og94e4ccvjssmu65 Hoërskool Natuur- en Skeikunde/Deel 3-4: Materie en Materiale 0 2128 6758 6749 2020-07-08T07:58:27Z Samuele2002 1787 Rol weergawe 6570 deur [[Special:Contributions/178.243.78.42|178.243.78.42]] ([[User talk:178.243.78.42|bespreek]]) terug. 6758 wikitext text/x-wiki ==Optiese Verskynsels en Eienskappe van Materiale== ===Transmissie en verstrooiing van Lig=== ===Uitstralings- en Absorpsie Spektra=== ===Lasers=== ===Die Fotoëlektriese Effek=== ==Organiese Molekules== ===Organiese Molekulêre Strukture=== ====Funksionele Groepe==== ====Versadigde en Onversadigde Strukture==== ====Isomere==== ===Sistematiese Benaming en Formules=== ===Reaksies=== ====Substitusie Reaksies==== ====Addisie Reaksies==== ====Eliminasie Reaksies==== ==Meganiese Eienskappe== In hierdie hoofstuk sal die meganiese (fisiese) eienskappe van verskeie materiale, soos alledaags gebruik, ondersoek word. Die meganiese eienskappe van 'n materiaal is daardie eienskappe wat geaffekteer word deur die uitwerking van toegepaste kragte op die materiaal. Hierdie eienskappe is belangrik vir waarneming wanneer daar na die konstruksie van geboue, strukture, of selfs die verskeie modusse van vervoer gekyk word. ===Vervormbaarheid van Materiale=== ====Hooke se Wet==== [[Lêer:Grafiek van Hooke se Wet met teks.png|thumb|left|250px|'n Grafiek wat die uitwerking van Hooke se Wet voorstel. Die verhouding tussen die veer se verlenging en die toegepaste krag daarop.]] Vervorming (verandering van vorm) van 'n soliede stof word veroorsaak deur 'n krag wat die voorwerp óf saampers óf uitstrek wanneer toegepas word in een rigting (of vlak). Kragte wat saampers probeer om die voorwerp kleiner of meer kompak te maak, terwyl trekkragte probeer om die voorwerp uitmekaar te skeur. Hierdie uitwerkings kan waargeneem word deur die samepersing en uitstrekking van 'n veer. Hooke se Wet beskryf die verhouding tussen die krag wat aangewend word op 'n veer en die uitstrekking daarvan. :'''Definisie van Hooke se Wet:''' in 'n elastiese veer sal die verlenging (die afstand wat die veer uitgerek word) daarvan lineêr varieer met die toegepaste krag. ''F = - k·x'' waar ''F'' die krag in newton (''N'') verteenwoordig, ''k'' is die veerkonstante (''N·m<sup>-1</sup>'') en ''x'' is die uitstrekking in meter (''m''). ====Afwykings van Hooke se Wet: Brosheid en Duktiliteit==== Dit is wel bekend indien 'n veer te ver uitgestrek word dit ophou ‘om te werk’. Die veer vervorm en verloor sy veeragtigheid. Wanneer dit gebeur is Hooke se Wet nie meer geldig nie, die veer se gedrag wyk af van Hooke se Wet. Die wyse waarop die veer se gedrag afwyk hang af van die veermateriaal. Materiale word geklassifiseer deur hierdie afwyking. Die volgende grafieke illustreer die verhouding tussen krag en uitstrekking daarvan vir verskillende materiale. Almal wyk af van Hooke se Wet. Onthou ook dat 'n reguit lyn dui eweredigheid aan; indien die grafiek nie langer 'n reguit lyn toon nie sal Hooke se Wet nie langer van toepassing wees nie. '''Bros materiale''' [[Lêer:Hooke se Wet - bros.png|thumb|right|200px|'n Harde, bros materiaal.]] Hierdie grafiek dui die verhouding tussen krag en uitstrekking aan vir 'n bros, maar sterk materiaal. Neem kennis van die min uitstrekking met 'n toename tot 'n groot krag, vanwaar die materiaal skielik breek. Brosheid is die eienskap van 'n materiaal wat dit maklik laat breek sonder om te buig. Glas is 'n goeie voorbeeld van 'n bros materiaal - soos wanneer 'n glas val en dit in stukke breek. [[Lêer:Hooke se Wet - plasties.png|thumb|left|200px|'n Plastiese materiaal se gedrag onderhewig aan 'n krag.]] '''Plastiese materiale''' Hier is 'n grafiek wat toon die verhouding tussen krag en verlenging van 'n plastiese materiaal. Die materiaal verleng onder die inwerking van 'n klein krag, maar daar dit breek nie. '''Duktiele materiale''' [[Lêer:Hooke se Wet - plasties.png|thumb|right|200px|'n Duktiele stof.]] Hierdie grafiek toon die verskil tussen die krag en verlening van 'n duktiele materiaal. Die materiaal toon plastiese gedrag oor 'n wye reeks kragte voor dit uiteindelik breek. Duktiliteit is die vermoë van 'n materiaal om gestrek te word tot 'n nuwe vorm sonder om te breek. Duktiliteit is ook een van die eienskappe van metale. 'n Goeie voorbeeld van só 'n materiaal is aluminium. Aluminium word gebruik in die vervaardiging van koeldrankblikkies tot vliegtuig onderdele, en selfs vir die enjinblokke van motors. Brosheid is die teenoorgestelde van duktiliteit. Wanneer 'n materiaal die punt bereik waar Hooke se Wet nie langer geldig is nie, word daardie punt as die ''eweredigheidsgrens'' beskou. Na hierdie punt sal die materiaal nie langer na sy oorspronklike vorm terugkeer nie, self al word al die kragte wat daarop inwerk verwyder. Dit word die ''elastisiteitsgrens'' genoem. :'''Definisie van elastisiteitsgrens''': die elastisiteitsgrens is daardie punt waarna permanente vervorming van 'n voorwerp plaasvind. :'''Definisie van eweredigheidsgrens''': die eweredigheidsgrens is daardie punt waarna Hooke se Wet nie langer geldig vir 'n voorwerp is nie. ====Elastisiteit en Plastisiteit==== Materiale word geklassifiseer as plasties of elasties afhangende van hul gedrag met toegepaste kragte. Dit is belangrik om daarop te let dat plastiese stowwe nie noodwendig 'n tipe plastiek ('n polimeer) is nie — die materiaal se gedrag is plasties. Die eienskappe daarvan is soortgelyk aan plastiek. 'n Rekkie is 'n voorbeeld van 'n elastiese materiaal. Dit neem weer sy oorspronklike vorm aan sodra die toegepaste krag verwyder word, mits dit nie verby die elastisiteitsgrens gestrek word nie. Kunsklei, of boetseerklei, is 'n voorbeeld van 'n plastiese materiaal. Indien 'n bal boetseerklei afgeplat word, sal dit plat bly. 'n Plastiese materiaal keer nie terug na die oorspronklike vorm nie, selfs al word die krag wat daarop inwerk verlig. *'''Elastiese materiale''' keer terug na hul oorspronklike vorm. *'''Plastiese materiale''' vervorm maklik en keer nie terug na hul oorspronklike vorms nie. ====Breekbaarheid, Kruip en Uitputting==== Sommige materiale is nóg plasties nóg elasties. Hierdie stowwe sal breek of kraak wanneer 'n groot genoeg krag op hulle inwerk. Bros glas wat voorheen genoem is, is 'n voorbeeld. Kruip kom voor wanneer 'n materiaal vervorm oor 'n lang tydperk onderhewig aan 'n krag wat daarop inwerk. 'n Voorbeeld hiervan is 'n rak waarop boeke geplaas is; die boekrak buig mettertyd. Kruip mag uiteindelik daartoe lei dat 'n voorwerp breek. Uitputting is eenders aan kruip. Die verskil tussen die twee is dat uitputting veroorsaak word deur 'n krag wat aanhoudend toegepas en verwyder word oor die verloop van tyd. Uitputting veroorsaak dat metale ingee, genoem metaaluitputting. *'''Breek''' is die skielike ingee van 'n materiaal. *'''Kruip''' is die stadige vervormingsproses weens die konstante inwerking van 'n krag oor tyd. *'''Uitputting''' is die verswakking van 'n materiaal deur die inwerking van krag vir 'n kort tydjie, maar herhaaldelik. ====Hooke se Wet en Spanningskettings==== ===Materiaalsterkte=== ====Die Eienskappe van Materie==== Die sterkte van 'n materiaal word gedefinieer as spanning (die krag per deursnee-area) wat dit kan weerstaan. Spanning word gemeet in newton per meter kwadraat (''N·m<sup>-2</sup>'').</br > *''Styfheid'' is 'n mate van die buigbaarheid van 'n materiaal. In Fisika word die styfheid van 'n materiaal bereken deur Young se Modulus te gebruik. Young se Modulus is 'n verhouding van die hoeveelheid wat 'n voorwerp buig met 'n spesifieke krag wat daarop inwerk. ''Styfheid'' word gemeet in newton per meter (''N·m<sup>-1</sup>'').</br > *''Hardheid'' van 'n materiaal kan gemeet word aan die wyse waarop 'n krag permanente vervorming van 'n materiaal laat plaasvind. Hardheid kan ook gemeet word deur 'n skaal, soos Mohs se hardheidskaal, te gebruik. Op hierdie skaal is 'n diamant die hardste teen 10 en talk, of speksteen, die sagste teen 1.</br > *''Gehardheid'' is die mate wat 'n materiaal breekpunt weerstand bied wanneer dit aan spanning onderwerp word. Dit is wetenskaplik gedefinieer as die hoeveelheid energie wat 'n materiaal kan absorbeer voor dit breek.</br > *'n ''Duktiele'' materiaal is 'n stof wat aansienlike plastiese vervorming kan ondergaan voor dit breek. Baie metale is baie duktiel en kan in drade gespan word, byvoorbeeld koper, silwer, aluminium en goud.</br > *'n ''Smeebare'' materiaal is 'n stof wat maklik plastiese vervorming kan ondergaan deur dit te hamer of rol. Weereens, metale is smeebaar, soos koper wat in plate gehamer kan word en aluminium wat tot aluminiumfoelie gerol word.</br > *'n ''Bros'' materiaal bereik breekpunt met baie min of geen plastiese vervorming. Glasware en keramiek is bros. ====Struktuur en Breekpunt van Materiale==== Baie stowwe faal omdat dit swakhede in hul atomiese struktuur het. Die is verskeie probleme wat swakhede in die materiaalstruktuur kan veroorsaak. Dit is gapings, dislokasies, greingrense en onsuiwerhede.</br > *''Gapings'' kom voor wanneer daar spasies in die struktuur van 'n kristalagtige vastestof gelaat word. Hierdie gapings veroorsaak swakhede en die stof faal gewoonlik by hierdie plekke. 'n Voorbeeld hiervan is bakstene in 'n muur — indien van die stene verwyder word sal die muur gevolglik verswak.</br > *''Dislokasies'' kom voor wanneer daar geen sterk bindings tussen twee rye in 'n kristalstruktuur is nie. Die kristal sal faal by hierdie grens wanneer genoegsame kragte daarop inwerk. Die twee stukke wan die kristal behou hul vorm en struktuur, maar beweeg saam met die grens.</br > *'n Verskil in die ''greingrootte'' van 'n kristalstruktuur kan veroorsaak dat roes en oksidasie by die grens plaasvind, wat gevolglik tot breekpunt kan lei indien genoeg krag op die materiaal inwerk.</br > *''Onsuiwerhede'' in 'n kristalstruktuur kan veroorsaak dat 'n verswakte gebied rondom die onsuiwerheid in die materiaal vorm. Soos gapings sal die stof gewoonlik ingee by hierdie plekke in die struktuur. Byvoorbeeld bakstene wat nie ordentlik in 'n muur inpas nie — net so 'n verkeerde atome in die struktuur wat veronderstel was om dit sterk te maak. ====Beheer oor die Eienskappe van Materiale==== Daar bestaan 'n hele aantal prosesse wat gebruik kan word om te verseker dat die waarskynlikheid afneem vir die faal van materiale. Hier volg 'n paar metodes: =====Koue Smeding===== Koue smeding is 'n proses waarby 'n metaal ''versterk'' word deur dit gedurig te vervorm. Gewoonlik vind dit plaas by 'n temperatuur net onder die smeltpunt van die metaal. Die herhaalde vorming van die metaal veroorsaak dislokasies wat weer enige verder dislokasies voorkom. Koue smeding verhoog die sterkte van die metaal, maar sodoende verloor die metaal sy duktiliteit. So 'n metaal is ''verstaal''. =====Uitgloeiing===== Uitgloeiing is 'n proses waarby 'n metaal hoogs verhit word tot 'n punt omtrent die helfte van die smeltpunt. Wanneer die metaal afkoel, kristalliseer dit om gapings en dislokasies uit die metaal te verwyder. Uitgloeiing word soms voor die koue smedingsproses gebruik. Die metaal word baie stadig afgekoel in die uitgloeiingsproses. =====Legeringsprosesse===== 'n Legering, of allooi, is 'n metaalmengsel met ander stowwe. Die proses waardeur die stowwe saamgevoeg en bewerk word word 'n legeringsproses genoem. Die ander stowwe kan 'n metaal of nie-metaal wees. 'n Allooi het dikwels eienskappe wat baie verskil van die eienskappe van die stowwe waarvan dit gemaak is. Die bygevoegde stowwe versterk die metaal deur die verspreiding van dislokasies te voorkom. Gewone staal is 'n allooi van yster en koolstof. Daar is baie tipes staal wat ook ander metale saam met yster en koolstof insluit. Brons is 'n allooi van koper en tin. Geelkoper is 'n allooi van koper en sink. Goud en silwer soos gebruik in munte en juweliersware is ook gelegeer. =====Tempering===== Tempering is 'n proses waar die metaal gesmelt en dan vinnig afgekoel word. Die vinnige afkoeling word blussing genoem. Gewoonlik word tempering 'n hele aantal kere gedoen voordat die metaal die regte eienskappe beskik so benodig vir 'n spesifieke toepassing. =====Sintering===== Sintering word gebruik vir die vervaardiging van onder andere keramiekvoorwerpe. In hierdie proses word die stof verhit sodat die deeltjies teen mekaar vasklou. Dit word gebruik met stowwe wat 'n baie hoë smeltpunt besit. Die produk is dikwels baie suiwer en word gegiet in die verlangde vorm in die proses. Ongelukkig is gesinterde produkte baie bros. ==Organiese Makromolekules== ===Plastieke en Polimere=== ====Termoplasties en Termoset==== ===Biologiese Makromolekules=== ====Struktuur==== ====Eienskappe==== ====Funksies==== f6z6uhrs59bj0v27nmt2487hlqj3bkp Hoërskool Natuur- en Skeikunde/Deel 1-5: Chemiese Verandering 0 2129 6667 6640 2020-05-21T10:27:51Z Sotiale 1034 Wysigings deur [[Special:Contributions/178.243.85.189|178.243.85.189]] teruggerol na laaste weergawe deur [[User:Meiræ|Meiræ]] 6478 wikitext text/x-wiki ==Fisiese en Chemiese Verandering== ===Mikroskopiese Interpretasie van Makroskopiese Veranderinge=== ===Skeiding van Deeltjies in Ontbinding- en Sintese Reaksies=== ===Bewaring van Atome en Massa=== ===Die Wet van Konstante Samestelling=== ===Bewaring van Energie=== ===Volumetriese Verhoudings in Gasreaksies=== ==Uiteensetting van Chemiese Verandering== ===Gebalanseerde Chemiese vergelykings=== 9bs45k2rbvecwuencvgylubngl4oegr Hoërskool Natuur- en Skeikunde/Deel 2-5: Chemiese Verandering 0 2130 6481 6462 2020-02-12T18:23:31Z Meiræ 1408 Rol weergawe 6462 deur [[Special:Contributions/159.146.18.89|159.146.18.89]] ([[User talk:159.146.18.89|bespreek]]) terug. 6481 wikitext text/x-wiki ==Kwantitatiewe Aspekte van Chemiese Verandering== ===Atoommassa=== ===Molekulêre en Formule Massas=== ===Die Bepaling van Stofsamestelling=== ===Hoeveelhede Stof=== ====Die mol==== ====Molêre Volume van Gasse==== ====Konsentrasie==== ===Stoichiometriese Berekeninge=== ==Energie en Chemiese Verandering== ===Energie Verandering en Bindingsenergieë=== ===Eksotermiese en Endotermiese Reaksies=== ===Aktiveringsenergie=== ==Tipes Reaksies== ===Suur-Basis Reaksies=== ===Redoksreaksies=== ===Substitusie, Addisie en Eliminasie Reaksies=== bvb6mokx563psma2vdwboson6ot79rr Hoërskool Natuur- en Skeikunde/Deel 3-5: Chemiese Verandering 0 2131 6756 6730 2020-07-08T02:52:55Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Minorax|Minorax]] 5709 wikitext text/x-wiki ==Tempo en Verloop van Chemiese Reaksies== ===Reaksietempo's en Invloede Daarop=== ====Eienskappe van Stowwe wat Reageer==== ====Konsentrasies==== ====Druk==== ====Temperatuur==== ====Die Teenwoordigheid van 'n Katalisator==== ===Die Meet van Reaksietempo's=== ===Reaksiemeganismes en Katalisatormeganismes=== ===Chemiese Ewewig en Invloede Daarop=== ===Ewewigskonstantes=== ===Toepassings van Ewewigsbeginsels=== ==Elektrochemiese Reaksies== ===Elektrolitiese en Galvaniese Selle=== ===Invloed van Reaksietempo en Ewewig op Stoom en Potensiaalverskil=== ===Die Proses van Redoksreaksies in Selle=== ===Standaard Elektrodepotensiale=== ===Vergelykings vir Oksidasie en Reduksie Halfreaksies=== ===Vergelykings vir Redoksreaksies=== k2vzv3o3rvu36z2nghhy25p6iefd0tv Hoërskool Natuur- en Skeikunde/Deel 1-6: Chemiese Sisteme 0 2132 6474 6415 2020-02-12T18:19:10Z Meiræ 1408 Rol weergawe 6415 deur [[Special:Contributions/159.146.18.89|159.146.18.89]] ([[User talk:159.146.18.89|bespreek]]) terug. 6474 wikitext text/x-wiki ==Algemene Siklusse== ===Die Watersiklus=== ====Fisiese Veranderinge en Energie-oordrag==== * Beweging van water * Vanaf die oseaan na die land * Beheer deur energie van sonlig * Reservoirs van water op Aarde ====Makroskopiese Eienskappe van Water==== ===Die Stikstofsiklus=== ====Chemiese Verandering en Energie-oordrag==== ====Beweging van Stikstof tussen Interafhanklike Biologiese en Geologiese Stelsels==== ====Industriële Fiksasie van Stikstof==== ==Die Hidrosfeer== ===Samestelling en Wisselwerking met ander Algemene Siklusse=== ===Ione in 'n Waterige Oplossing=== ====Wisselwerking en Invloede==== * Elektroliete, Mate van Ionisasie soos Gemeet deur Geleidingsvermoë * Neerslagreaksies 2nbiwxvhv57heg3sn68raqzwux8jquw Hoërskool Natuur- en Skeikunde/Deel 2-6: Chemiese Sisteme 0 2133 6752 6740 2020-07-08T02:52:53Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Sotiale|Sotiale]] 6565 wikitext text/x-wiki lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości. lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości. lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości.    lewo wielki ka rem pokryty komin, przypierał do alchemicznego piecyka, na teraz zagasłego. Mnóstwo ziół schły porozwieszane i porozrzucane.  Słabe światło okna jednego powiększało jeszcze dziwaczność tej izby, nie dając dojrzeć niczego dokładnie: głowa tylko, którą zwać będziem terafim, kościotrup w kącie, mumia w swych powijaczach w drugim, wyglądały z cieniów.  Dwóch ludzi znajdowali się w pośrodku za stołem. Jeden maleńki, garbaty, łysy, z rudą brodą i okiem jednem zagasłem, zmrużonem, drugi poważny, piękny, słusznego wzrostu, dumnej postawy, w czarnej sukni z łańcuchem na szyi.  Mały zwał się Duran, słuszny Gronovius. Znać było że pierwszy był nie jako pomocnikiem tylko i anima damnata drugiego; chociaż w twarzy Gronoviusa, pięknej i na pozór nawet szlachetnej, w oczach jego zmrużonych, wargach przyciętych sarkastycznie, czytać było można, że i bez pomocnika chytry cudzoziemiec byłby się obszedł; sam by potrafił sobie wystarczyć.  Gronovius zajęty był pisaniem listu, Duranus rysował kwadrat magiczny napełniony liczbami, które naprzemian kreślił czarno, niebiesko i czerwono.  — Mistrzu, ozwał się chwilką przed nadejściem księcia poczwarny karzeł, szydersko, złośliwie, jak wam się zdaje, król JM. rad będzie swojemu kwadratowi?  — Nie przeszkadzaj mi pisać.  — A gdybym koniecznie chciał przeszkadzać? dodał złośliwy karzeł.  — W takim razie powiedz mi, to wcześnie przestanę.  — Nie, nie, pisz, chciałem tylko sprobować twojej cierpliwości. ==Benutting van die Litosfeer (die Aardkors)== ===Mynwese en Mineraalprosessering=== * Goud * Yster * Fosfate * (Suid-Afrikaanse Fokus) ===Energiehulpbronne en Gebruike=== ==Die Atmosfeer== ===Atmosferiese Chemie=== ===Aardverwarming=== ===Die Omgewingsimpak van Bevolkingstoename=== b8xtg92ewi5hog1pxs352ec0e8z69jn Hoërskool Natuur- en Skeikunde/Deel 3-6: Chemiese Sisteme 0 2134 6045 5850 2020-01-08T21:34:10Z ~riley 993 Wysigings deur [[Special:Contributions/178.243.20.235|178.243.20.235]] teruggerol na laaste weergawe deur [[User:196.213.107.113|196.213.107.113]] 4864 wikitext text/x-wiki ==Die Chemiese Industrie== ===Hulpbronne, Noodsaaklikhede en die Skakels=== ====Sasol en Brandstowwe==== Brandstowwe word alledaags gebruik in die apartheidjare het die wereld besluit om nie meer brandstof te verskaf aan die land Suid-Afrika. Sasol het toe met die proses van kraking deur om lang koolstof kettings te vat en kleiner ketting te vervaardig met gebruik van steunkool. Brandstof is toe vervaardig. ====Monomere, Polimere en Polimerisasie==== ====Die Chloor-alkali Industrie==== ====Die Kunsmis Industrie==== cfra5os4z0vwasvn02kfplsohoqcq6u Bespreking:Hoërskool Natuur- en Skeikunde 1 2135 6263 6262 2020-02-08T23:18:32Z Hasley 2021 Wysigings deur [[Special:Contributions/159.146.45.76|159.146.45.76]] teruggerol na laaste weergawe deur [[User:Hasley|Hasley]] 5701 wikitext text/x-wiki ''Hoërskool Natuur- en Skeikunde'', soos hier gegee, is rofweg op die Suid-Afrikaanse leerplan gebaseer. Die inhoudsopgawe en struktuur vir die verskillende onderwerpe is solank geplaas. Voel vry om dit te verander en die onderwerpe uit te brei. [[Gebruiker:Atoom|Atoom]] 07:10, 24 Mei 2010 (UTC) hx6ocd4h58ph738j28bes7bmdnkwldg Die Engelse taal 0 2136 3923 2010-05-29T01:32:58Z ThePCKid 535 [[Die Engelse taal]] geskuif na [[Die Engels taal]]: Misspelling 3923 wikitext text/x-wiki #AANSTUUR [[Die Engels taal]] jtu76ld0677c0eviop0et2dhp2p8rci Die Engelse taal/Les1 0 2137 3926 2010-05-29T01:34:36Z ThePCKid 535 [[Die Engelse taal/Les1]] geskuif na [[Die Engels taal/Les1]] 3926 wikitext text/x-wiki #AANSTUUR [[Die Engels taal/Les1]] n018uq5378uz9ej8xuji3hrpw8v17ec Die Engelse taal/Les2 0 2138 3928 2010-05-29T01:34:53Z ThePCKid 535 [[Die Engelse taal/Les2]] geskuif na [[Die Engels taal/Les2]] 3928 wikitext text/x-wiki #AANSTUUR [[Die Engels taal/Les2]] c8m71j4u9w3xo9jrrk1hxbrrgv7tc3k Gebruiker:Vinhtantran/vector.js 2 2139 6825 3945 2021-02-04T23:32:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6825 javascript text/javascript mw.loader.load('https://vi.wikipedia.org/w/index.php?title=User:Vinhtantran/globalvector.js&action=raw&ctype=text/javascript'); aewun12h7cosrw38ecu5f4n7f7firbp Gebruiker:Atoom/Boeke/Hoërskool Natuur- en Skeikunde 2 2140 4349 4012 2011-11-13T13:09:13Z Jan Slimkop 326 4349 wikitext text/x-wiki == Hoërskool Natuur- en Skeikunde == :[[Hoërskool Natuur- en Skeikunde]] :[[Deel 1-1: Meganika]] :[[Deel 1-2: Golwe, Klank en Lig]] :[[Deel 1-3: Elektrisiteit en Magnetisme]] :[[Deel 1-4: Materie en Materiale]] :[[Deel 1-5: Chemiese Verandering]] :[[Deel 1-6: Chemiese Sisteme]] :[[Deel 2-1: Meganika]] :[[Deel 2-2: Golwe, Klank en Lig]] :[[Deel 2-3: Elektrisiteit en Magnetisme]] :[[Deel 2-4: Materie en Materiale]] :[[Deel 2-5: Chemiese Verandering]] :[[Deel 2-6: Chemiese Sisteme]] :[[Deel 3-1: Meganika]] :[[Deel 3-2: Golwe, Klank en Lig]] :[[Deel 3-3: Elektrisiteit en Magnetisme]] :[[Deel 3-4: Materie en Materiale]] :[[Deel 3-5: Chemiese Verandering]] :[[Deel 3-6: Chemiese Sisteme]] [[Kategorie:Boeke|Hoërskool Natuur- en Skeikunde]] qjvcy81mxl9yttjduj5ss20ycla586o Deel 1-1: Meganika 0 2141 4022 2010-06-17T09:31:05Z Atoom 536 [[Deel 1-1: Meganika]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-1: Meganika]] 4022 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-1: Meganika]] rbkougpeh7ghpgmfjojvikazhb3nuh1 Deel 1-2: Golwe, Klank en Lig 0 2142 4024 2010-06-17T09:32:41Z Atoom 536 [[Deel 1-2: Golwe, Klank en Lig]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-2: Golwe, Klank en Lig]] 4024 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-2: Golwe, Klank en Lig]] 2sb9vu279cfre8k5i02sqd70qghq7m1 Deel 1-3: Elektrisiteit en Magnetisme 0 2143 4026 2010-06-17T09:33:09Z Atoom 536 [[Deel 1-3: Elektrisiteit en Magnetisme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-3: Elektrisiteit en Magnetisme]] 4026 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-3: Elektrisiteit en Magnetisme]] 8v2spz0d4oj8xtfdvh2si6dz3raeelo Deel 1-4: Materie en Materiale 0 2144 4028 2010-06-17T09:33:37Z Atoom 536 [[Deel 1-4: Materie en Materiale]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-4: Materie en Materiale]] 4028 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-4: Materie en Materiale]] s6vvvzkzvi0z0vuvrq7j14u4i5bbb9n Deel 1-5: Chemiese Verandering 0 2145 4030 2010-06-17T09:34:02Z Atoom 536 [[Deel 1-5: Chemiese Verandering]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-5: Chemiese Verandering]] 4030 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-5: Chemiese Verandering]] bz7y9ex6e99o6w22k38sb19xcoq0btv Deel 1-6: Chemiese Sisteme 0 2146 4032 2010-06-17T09:34:41Z Atoom 536 [[Deel 1-6: Chemiese Sisteme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 1-6: Chemiese Sisteme]] 4032 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 1-6: Chemiese Sisteme]] jskrlzkr0cvnhk7zlscw5bpsd3n2o8d Deel 2-1: Meganika 0 2147 4035 2010-06-17T09:36:59Z Atoom 536 [[Deel 2-1: Meganika]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-1: Meganika]] 4035 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-1: Meganika]] lat9yz8swdf0rajitgnafmu3dltxezs Deel 2-2: Golwe, Klank en Lig 0 2148 4037 2010-06-17T09:37:26Z Atoom 536 [[Deel 2-2: Golwe, Klank en Lig]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-2: Golwe, Klank en Lig]] 4037 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-2: Golwe, Klank en Lig]] bkx022p8v71xnsxfpgj6bwfrt4chiqs Deel 2-3: Elektrisiteit en Magnetisme 0 2149 4039 2010-06-17T09:37:58Z Atoom 536 [[Deel 2-3: Elektrisiteit en Magnetisme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-3: Elektrisiteit en Magnetisme]] 4039 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-3: Elektrisiteit en Magnetisme]] 7ut3xbtfpmu6zttgoygjhjll5j7jwok Deel 2-4: Materie en Materiale 0 2150 4041 2010-06-17T09:38:25Z Atoom 536 [[Deel 2-4: Materie en Materiale]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-4: Materie en Materiale]] 4041 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-4: Materie en Materiale]] 40hq2icbin0kfqpfqzv01neztio0x4u Deel 2-5: Chemiese Verandering 0 2151 4043 2010-06-17T09:38:48Z Atoom 536 [[Deel 2-5: Chemiese Verandering]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-5: Chemiese Verandering]] 4043 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-5: Chemiese Verandering]] hntxk4jm2d3two2rgjd6k3ladwaw0jh Deel 2-6: Chemiese Sisteme 0 2152 4045 2010-06-17T09:39:10Z Atoom 536 [[Deel 2-6: Chemiese Sisteme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 2-6: Chemiese Sisteme]] 4045 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 2-6: Chemiese Sisteme]] 24507zv5vyzzzmr2ojy1hr8vdxk15m9 Deel 3-1: Meganika 0 2153 4048 2010-06-17T09:40:34Z Atoom 536 [[Deel 3-1: Meganika]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-1: Meganika]] 4048 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-1: Meganika]] styt0j4tm4idrp58w7obah30jlmpyxi Deel 3-2: Golwe, Klank en Lig 0 2154 4050 2010-06-17T09:40:57Z Atoom 536 [[Deel 3-2: Golwe, Klank en Lig]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-2: Golwe, Klank en Lig]] 4050 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-2: Golwe, Klank en Lig]] euhag9p1oejpgsbmm92xok9q6zrkm05 Deel 3-3: Elektrisiteit en Magnetisme 0 2155 4052 2010-06-17T09:41:22Z Atoom 536 [[Deel 3-3: Elektrisiteit en Magnetisme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-3: Elektrisiteit en Magnetisme]] 4052 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-3: Elektrisiteit en Magnetisme]] 0z00q7p2t7mg2soqsgwls7kc961l45s Deel 3-4: Materie en Materiale 0 2156 4054 2010-06-17T09:41:59Z Atoom 536 [[Deel 3-4: Materie en Materiale]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-4: Materie en Materiale]] 4054 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-4: Materie en Materiale]] 0kbl0joiwoemirepsd23xg8evwy5zi7 Deel 3-5: Chemiese Verandering 0 2157 4056 2010-06-17T09:42:24Z Atoom 536 [[Deel 3-5: Chemiese Verandering]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-5: Chemiese Verandering]] 4056 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-5: Chemiese Verandering]] lut7xuqovrs9bi0utceuq1s078de0oq Deel 3-6: Chemiese Sisteme 0 2158 4058 2010-06-17T09:42:47Z Atoom 536 [[Deel 3-6: Chemiese Sisteme]] geskuif na [[Hoërskool Natuur- en Skeikunde/Deel 3-6: Chemiese Sisteme]] 4058 wikitext text/x-wiki #AANSTUUR [[Hoërskool Natuur- en Skeikunde/Deel 3-6: Chemiese Sisteme]] rw83vrhis5fhvdk5kzno51gkcx2clmw Gebruiker:Atoom/Boeke/Skeinat 2 2 2159 4068 2010-06-17T14:12:58Z Atoom 536 Nuwe bladsy geskep met '{{gestoorde_boek}} == Hoërskool Natuur- en Skeikunde == :[[Hoërskool Natuur- en Skeikunde]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-1: Meganika]] :[[Hoërskool Natuur- ...' 4068 wikitext text/x-wiki {{gestoorde_boek}} == Hoërskool Natuur- en Skeikunde == :[[Hoërskool Natuur- en Skeikunde]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-1: Meganika]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-2: Golwe, Klank en Lig]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-3: Elektrisiteit en Magnetisme]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-4: Materie en Materiale]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-5: Chemiese Verandering]] :[[Hoërskool Natuur- en Skeikunde/Deel 3-6: Chemiese Sisteme]] [[Kategorie:Boeke|Skeinat 2]] ak1dm5c8lbbyrxhj09jtel31ujb0j26 Gebruiker:Razorflame 2 2162 4071 2010-06-20T00:05:13Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4071 wikitext text/x-wiki Please see [[m:wikt:en:User:Razorflame|my userpage]]. Thanks! <div style="float:left; margin:1px; border:1px solid #6EF7A7;"> {| cellspacing="0" style="width:238px; background:#C5FCDC;" | style="width:45px; height:45px; background:#6EF7A7; text-align:center; font-size:14pt;" | '''en''' | style="padding:4pt; line-height:1.25em; font-size:8pt;" | This user is a '''native''' speaker of '''English'''. |} </div> p9rt1myknldnnduywuuhofeui7rl1gh Gebruiker:J.delanoy/monobook.js 2 2165 6796 4074 2021-02-04T23:27:58Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6796 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:J.delanoy/global.js&action=raw&ctype=text/javascript'); aug51frfbndh8772bte9gjoqwr8iooi Gebruiker:Kuvaly/vector.js 2 2167 6803 4076 2021-02-04T23:29:08Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6803 javascript text/javascript mw.loader.load('https://cs.wikipedia.org/w/index.php?title=User:Kuvaly/global.js&action=raw&ctype=text/javascript'); lpm0f7l9tjqvfb8xarwkwe3ozc36okp Gebruiker:Mike.lifeguard/vector.js 2 2172 7152 4083 2021-12-30T22:11:39Z Ladsgroup 1827 Maintenance: Fixing deprecated call to importScriptURI ([[mw:ResourceLoader/Migration_guide_(users)#importScriptURI]]) 7152 javascript text/javascript function importAnyScript(lang,family,script) { mw.loader.load('http://' + encodeURIComponent(lang) + '.' + encodeURIComponent(family) + '.org/w/index.php?title=' + encodeURIComponent(script) + '&action=raw&ctype=text/javascript'); } importAnyScript('meta','wikimedia','User:Mike.lifeguard/remote.js'); lilrd1en4uqg2rwds3dbg7six3k5nfo Gebruiker:Wikitanvir 2 2184 4603 4602 2012-12-28T10:52:34Z Wikitanvir 549 New design 4603 wikitext text/x-wiki <div style="padding: 12px 18px 5px 15px; width: absolute; border: 2px solid #000; background: #F5F5F5; color: #000; text-align: justify;">The purpose of this user page is to point you to the right direction where you can contact me in need. Please do not leave your message here, otherwise in most cases, they will not be noticed in time and eventually be removed. However, you are encouraged to contact me or say hello. :-) Please note that I can communicate in either Bangla or English. My apologies for not knowing your language. If you prefer to leave me a message, please choose any of the following talk pages I maintain frequently. * [[m:User talk:Wikitanvir|Meta-Wiki talk page]] * [[m:bn:User talk:Wikitanvir|Bangla Wikipedia talk page]] (my home wiki) * [[m:en:User talk:Wikitanvir|English Wikipedia talk page]] * [[m:commons:User talk:Wikitanvir|Wikimedia Commons talk page]] If you have something to say to me in private, e-mail is a good option. * If you are logged in to your Wikimedia account you can probably e-mail me by [[Special:EmailUser/Wikitanvir|clicking here]]. * Otherwise, you can e-mail me directly to <span style="text-transform: lowercase;">{{PAGENAME}}</span>[[File:At sign.svg|17px|&nbsp;at&nbsp;|link=]]gmail.com. Finally, if you are interested to know about my work or myself, they can be found on [[m:User:Wikitanvir|my Meta-Wiki user page]]. </div><!-- # USEFUL STATISTICS TABLE --> {| class="wikitable" width="100%" style="border: 2px solid #000;" ! style="width: 11%; background: #CCC;" | [[Special:AllPages|Articles]] ! style="width: 10%; background: #CCC;" | [[Special:ListFiles|Files]] ! style="width: 13%; background: #CCC;" | [[Special:ListUsers|Users]] ! style="width: 11%; background: #CCC;" | [[Special:ActiveUsers|Active Users]] ! style="width: 10%; background: #CCC;" | [[Special:ListUsers/bot|Bots]] ! style="width: 11%; background: #9F0; border: 2px solid #000;" | [[Special:ListUsers/sysop|Sysops]] ! style="width: 12%; background: #CC9; border: 2px solid #000;" | [[Special:ListUsers/bureaucrat|Bureaucrats]] ! style="width: 11%; background: #FC0; border: 2px solid #000;" | [[Special:ListUsers/checkuser|CheckUsers]] ! style="width: 12%; background: #6FF; border: 2px solid #000;" | [[Special:ListUsers/oversight|Oversighters]] |- style="background: #F5F5F5; font-size: 110%; text-align: center;" | {{NUMBEROFARTICLES}} || {{NUMBEROFFILES}} || {{NUMBEROFUSERS}} || {{NUMBEROFACTIVEUSERS}} || {{NUMBERINGROUP:bot}} || style="background: #9F0; border: 2px solid #000;" | '''{{NUMBEROFADMINS}}''' || style="background: #CC9; border: 2px solid #000;" | '''{{NUMBERINGROUP:bureaucrat}}''' || style="background: #FC0; border: 2px solid #000;" | '''{{NUMBERINGROUP:checkuser}}''' || style="background: #6FF; border: 2px solid #000;" | '''{{NUMBERINGROUP:oversight}}''' |}<!-- TA! --> ahoeqk0hrgtqwlhdcefzbqa8ywxmr28 Gebruiker:Atoom 2 2186 4102 4101 2010-07-16T09:14:08Z Atoom 536 /* Kortpaaie */ 4102 wikitext text/x-wiki ==Kortpaaie== *[[:en:FHSST_Physics| The Free High School Science Texts - Physics]] *[[:en:Category:FHSST Physics/Images]] 2x5t7oaxwr9lgztw3e7y5k47tszhyov Gebruiker:Drini 2 2187 4104 2010-07-16T15:25:27Z Dferg 303 [[Gebruiker:Drini]] geskuif na [[Gebruiker:Magister Mathematicae]]: Bladsy is outomaties geskuif met die wysiging van die gebruiker "[[User:Drini|Drini]]" na "[[User:Magister Mathematicae|Magister Mathematicae]]" 4104 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Magister Mathematicae]] 4e5a3p4polin5lgnagqgyx9zzgunbc7 Gebruiker:Fr33kman 2 2188 4108 4107 2010-07-24T23:24:29Z Fr33kman 497 fix 4108 wikitext text/x-wiki [[File:Admin mop.PNG|right|25px]] ==About Me== Hello! I am [[:m:User:Fr33kman|Fr33kman]] and I am a [[:m:Global sysop|global sysop]] <small>([http://meta.wikimedia.org/w/index.php?title=Special:GlobalUsers&username=Fr33kman&group=Global_sysops&limit=50 verify])</small>. This means that I have administrative rights on many projects, including this one. <small> *[[File:Flag of France.svg|15px]] - Bonjour! Je suis Fr33kman et je suis un sysop mondiale. Cela signifie que j'ai des droits d'administration ici. *[[File:Flag of Germany.svg|15px]] - Hallo! Ich bin Fr33kman und ich bin ein globales sysop. Dies bedeutet, dass ich hier über Administratorrechte verfügen. *[[File:Flag of Spain.svg|15px]] - ¡Hola! Soy Fr33kman, y soy un administrador global. Esto significa que tengo derechos administrativos en muchos proyectos, incluyendo éste. *[[File:Flag of Russia.svg|15px]] - Я Fr33kman и я глобальной сисоп. Это означает, что я прав администратора на многих проектах, в том числе это один *[[File:Flag of Netherlands.svg|15px]] - Ik ben Fr33kman en ik ben een wereldwijde sysop. Dit betekent dat ik administratieve rechten hebben op de vele projecten, waaronder deze. '''''<font color="darkgreen">[[User:Fr33kman|fr33k]]</font><font color="blue">[[User talk:Fr33kman|man]]</font> <font color="darkgreen" size="1">[[w:simple:User:Fr33kman|-s-]]</font>''''' ===How to contact me=== The best way to contact me is [[Special:EmailUser/Fr33kman|email]] or [[:w:simple:User talk:Fr33kman|here]]. 1tiqaqgecvnu5bkatje6yycoea0o6y5 Gebruikerbespreking:Fr33kman 3 2189 4106 2010-07-24T23:09:34Z Fr33kman 497 redirect 4106 wikitext text/x-wiki #REDIRECT[[User:Fr33kman]] tt57gp57zeclib7ml1qyumio5c482ln Gebruiker:Kanjy 2 2190 4109 2010-08-01T02:48:25Z Kanjy 60 new userpage: babel, links to my home wiki etc. 4109 wikitext text/x-wiki {|style="float:right" |- !style="border:1px solid #6c9"|[[w:Japannees|ja]] |style="border:1px solid #9fc"|日本語を母語としています |- !style="border:1px solid #69c"|[[w:Engels|en]]-2 |style="border:1px solid #9cf"|intermediate level of English |- !style="border:1px solid #96c"|[[w:Duits|de]]-1 |style="border:1px solid #c9f"|grundlegende Deutschkenntnisse |- !style="border:1px solid #c69"|[[w:Afrikaans|af]]-0 |style="border:1px solid #f9c"|verstaan nie Afrikaans nie |} <!-- {{Babel|ja|en-2|de-1|af-0}} --> * <span class="plainlinks" title="w:ja:User:Kanjy">[http://ja.wikipedia.org/wiki/User:Kanjy w:ja:User:Kanjy]</span> (<span class="plainlinks" title="w:ja:User talk:Kanjy">[http://ja.wikipedia.org/wiki/User_talk:Kanjy talk]</span>) - Japanese Wikipedia, my home wiki * [[:ja:User:Kanjy]] ([[:ja:User_talk:Kanjy|talk]]) - Japanese Wikibooks, semi-home * [[m:User:Kanjy]] ([[m:User_talk:Kanjy|talk]]) - Meta * [[sulutil:Kanjy]] - my global account [[de:Benutzer:Kanjy]] [[en:User:Kanjy]] [[es:Usuario:Kanjy]] [[fr:Utilisateur:Kanjy]] [[it:Utente:Kanjy]] [[ja:利用者:Kanjy]] [[pt:Usuário:Kanjy]] [[zh:User:Kanjy]] icm6gf69wqxzs1uf09rz06dp868vtpz Gebruiker:Memo18 2 2191 4110 2010-08-03T00:31:31Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4110 wikitext text/x-wiki <div style="background:LightBlue; overflow:auto; padding:10px;">Hi! See my page in [[m:ro:User:Memo18|romanian]].</div> 4vupc4gqlw7zu53y6q646ybvegjr6ib Gebruiker:Memo18/vector.css 2 2192 4111 2010-08-03T01:39:38Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4111 css text/css @import "http://meta.wikimedia.org/w/index.php?title=User:Memo18/vector.css&action=raw&ctype=text/css"; o9ykiatro07zdw4ch86s4jgoazh6kyj Gebruiker:MediaWiki default 2 2193 4112 2010-08-03T07:28:23Z 188.180.67.207 jwmAEFTvGjriqlntZKS 4112 wikitext text/x-wiki comment4, 55j99znh7axhggm9fyuskfx2dt6o9t0 Gebruiker:Manuelt15 2 2196 4118 4117 2010-08-05T10:51:51Z Abigor 391 Fix after request on my [[:meta:User:Abigor|Talk page]] 4118 wikitext text/x-wiki <div style="min-height: 57px; border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 50%; margin: 0 auto 1em auto; padding: .2em; text-align: justify;"> <div style="float: left">[[File:Metawiki.svg|50px| ]]</div> <div style="margin-left: 60px">'''[[m:Soft redirect|Interwiki redirect]]'''<br />This page can be found at [[m:User:Manuelt15|Meta-Wiki]].</div> </div> mrpg2ux8t3yptl42nr8vch5c6qxcm1e Gebruiker:WinContro 2 2197 4120 2010-08-06T12:09:29Z Abigor 391 Requested on IRC 4120 wikitext text/x-wiki <div style="min-height: 57px; border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 50%; margin: 0 auto 1em auto; padding: .2em; text-align: justify;"> <div style="float: left">[[File:Metawiki.svg|50px| ]]</div> <div style="margin-left: 60px">'''[[m:Soft redirect|Interwiki redirect]]'''<br />This page can be found at [[:w:nl:User:WinContro|Dutch Wikipedia]].</div> </div> nnqjim9i4o87og55w0rq2dwdhw0czo8 Gebruiker:Manuelt15/vector.js 2 2198 4121 2010-08-07T02:42:14Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4121 javascript text/javascript importScriptURI('http://meta.wikimedia.org/w/index.php?title=User:Manuelt15/global.js&action=raw&ctype=text/javascript') f64hpcwq4zpywi9ytax6wop9gtnha8z Gebruiker:Manuelt15/monobook.js 2 2199 6809 4122 2021-02-04T23:30:08Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6809 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Manuelt15/global.js&action=raw&ctype=text/javascript'); e9ouft4iybh1txmhj9r9cy6yoqkoen0 Gebruiker:Juhko/monobook.js 2 2200 6798 4123 2021-02-04T23:28:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6798 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Juhko/global.js&action=raw&ctype=text/javascript'); 74oghvoywm8aj2m7ngs52yo4xhfu30z Gebruiker:Juhko/vector.js 2 2201 6799 4124 2021-02-04T23:28:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6799 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Juhko/global.js&action=raw&ctype=text/javascript'); 74oghvoywm8aj2m7ngs52yo4xhfu30z Gebruikerbespreking:Wikitanvir 3 2202 4601 4600 2012-12-27T20:45:51Z Wikitanvir 549 New design 4601 wikitext text/x-wiki <div style="padding: 12px 18px 5px 15px; width: absolute; border: 2px solid #000; background: #F5F5F5; color: #000; text-align: justify;">The purpose of this user page is to point you to the right direction where you can contact me in need. Please do not leave your message here, otherwise in most cases, they will not be noticed in time and eventually be removed. However, you are encouraged to contact me or say hello. :-) Please note that I can communicate in either Bangla or English. My apologies for not knowing your language. If you prefer to leave me a message, please choose any of the following talk pages I maintain frequently. * [[m:User talk:Wikitanvir|Meta-Wiki talk page]] * [[m:bn:User talk:Wikitanvir|Bangla Wikipedia talk page]] (my home wiki) * [[m:en:User talk:Wikitanvir|English Wikipedia talk page]] * [[m:commons:User talk:Wikitanvir|Wikimedia Commons talk page]] If you have something to say to me in private, e-mail is a good option. * If you are logged in to your Wikimedia account you can probably e-mail me by [[Special:EmailUser/Wikitanvir|clicking here]]. * Otherwise, you can e-mail me directly to <span style="text-transform: lowercase;">{{PAGENAME}}</span>[[File:At sign.svg|17px|&nbsp;at&nbsp;|link=]]gmail.com. Finally, if you are interested to know about my work or myself, they can be found on [[m:User:Wikitanvir|my Meta-Wiki user page]]. </div><!-- TA! --> 46rbmfnj1oqhjlb6img5ahdr3pfxybv Gebruiker:Shanel/vector.js 2 2204 6817 4127 2021-02-04T23:31:28Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6817 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Shanel/global.js&action=raw&ctype=text/javascript'); 14p5zkc7ozc0y8n5twgu541naa3a33d Gebruiker:Shanel/vector.css 2 2205 4128 2010-08-08T02:24:21Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4128 css text/css import url('http://meta.wikimedia.org/w/index.php?title=User:Shanel/global-vector.css&action=raw&ctype=text/css'); 6lokmzprxyvba9z7tqbs9f5jo3rqp70 Gebruiker:Pilif12p 2 2206 4129 2010-08-08T09:02:08Z Abigor 391 global userpage 4129 wikitext text/x-wiki {| style="border: #AAAAAA 1px solid; background: #F9F9F9; margin-left: auto; margin-right: auto; width: 40%; min-height: 57px" | [[Image:Blue Glass Arrow.svg|50px]] | '''[[m:Soft redirect|Soft redirect]]''' This page can be found at [[Wikipedia:User:Pilif12p]]. |} m20cgwcs7kmq7dazwmnjrvgp5vzlqzr Gebruiker:Quentinv57 2 2207 4131 2010-08-16T21:07:55Z Quentinv57 577 Redirected to [[meta:User:Quentinv57]] 4131 wikitext text/x-wiki {{Softredirect|meta:User:Quentinv57}} tpoqwz8k33kao379ipdrsfbabv12jsh Gebruikerbespreking:Quentinv57 3 2208 4132 2010-08-16T21:08:06Z Quentinv57 577 Redirected to [[meta:User talk:Quentinv57]] 4132 wikitext text/x-wiki {{Softredirect|meta:User talk:Quentinv57}} 48m7gb8whgermtd1zo16iz8fu2if5h9 Gebruiker:Jalexander-WMF 2 2214 4866 4146 2014-08-17T23:20:40Z MF-Warburg 42 MF-Warburg het bladsy [[Gebruiker:Jalexander]] na [[Gebruiker:Jalexander-WMF]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Jalexander|Jalexander]]" to "[[Special:CentralAuth/Jalexander-WMF|Jalexander-WMF]]" 4866 wikitext text/x-wiki My name is James Alexander, I am an Associate Community Officer with the [[wmf:Main Page|Wikimedia Foundation]] and am working to help with this year's [[m:fundraising 2010|Fundraiser]]. This account is used for edits while officially working for the foundation. You can reach me either through email (Jalexander[[File:At_sign.svg|17px| at |link=]]wikimedia.org) or on my [[m:User talk:Jalexander|Meta talk page]]. On wiki I use [[m:User:Jamesofur|Jamesofur]] in my volunteer role and this account [[m:User:Jalexander|Jalexander]] in my WMF staff role. In my volunteer capacity I can usually be found on the [[w:en:Main page|enWikipedia]], [[w:simple:Main page|SimpleWikipedia]] or on [[m:Main page|MetaWiki]] where I am an elected administrator as well as working on cross-wiki abuse as a [[m:Global sysop|Global sysop]] For more contact info please see [[m:User:Jalexander|my MetaWiki userpage]]. dy6n4i5h6pi3dironfvr2bissmkvefw Gebruiker:Hosiryuhosi 2 2215 5600 5598 2018-10-21T03:52:12Z Rxy 1940 Rxy het bladsy [[Gebruiker:😀]] na [[Gebruiker:Hosiryuhosi]] oor 'n bestaande aanstuur geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/😀|😀]]" to "[[Special:CentralAuth/Hosiryuhosi|Hosiryuhosi]]" 5598 wikitext text/x-wiki *[[meta:User:Hosiryuhosi|meta]] tvbxoz76wh7g2vheazjd2k6vjn41ftw Gebruiker:Kpeterzell 2 2217 4141 2010-09-02T06:21:26Z Jalexander-WMF 586 (global staff user pages as requested. [[m:User talk:Jalexander|Questions?]]) 4141 wikitext text/x-wiki Hello. I'm [[w:User:Keegan|Keegan Peterzell]]. I'm working for the Wikimedia Foundation temporarily on Fundraising 2010 as an Associate Community Officer. Edits made under this account are on behalf of the Wikimedia Foundation as a staff member. Feel free to contact me anytime with questions about the Fundraiser. s1riz8icp2pwlyer2902i788r0zau23 Gebruiker:Kwj2772/vector.js 2 2219 6806 4143 2021-02-04T23:29:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6806 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Kwj2772/remote.js&action=raw&ctype=text/javascript'); all618nkhyirfofwcdjue9b5yuhoyrl Gebruiker:Koavf 2 2220 4148 2010-09-20T21:54:29Z Koavf 20 Nuwe bladsy geskep met '[http://en.wikipedia.org/wiki/User:Koavf !!!!]' 4148 wikitext text/x-wiki [http://en.wikipedia.org/wiki/User:Koavf !!!!] bakkeq13eza7yhu7n9buvny7z38rbae Gebruiker:CnkALTDS 2 2221 4149 2010-09-23T20:47:25Z CnkALTDS 595 Nuwe bladsy geskep met 'Please see [[m:User:CnkALTDS]] <small>~~~~</small>' 4149 wikitext text/x-wiki Please see [[m:User:CnkALTDS]] <small>—[[User talk:CnkALTDS|<font color="cadetblue">CnkALTDS</font>]] 20:47, 23 September 2010 (UTC)</small> g3dnswn9gl5092jlmi6eyhnlt4orrxk Gebruikerbespreking:CnkALTDS 3 2222 4150 2010-09-23T20:47:47Z CnkALTDS 595 Nuwe bladsy geskep met 'Please see [[m:User talk:CnkALTDS]] <small>~~~~</small>' 4150 wikitext text/x-wiki Please see [[m:User talk:CnkALTDS]] <small>—[[User talk:CnkALTDS|<font color="cadetblue">CnkALTDS</font>]] 20:47, 23 September 2010 (UTC)</small> es6utwgiq5l1p60aiinupu6wf3uc8fc Gebruiker:Dgultekin 2 2223 4152 4151 2010-09-29T20:21:25Z Jalexander-WMF 586 ( updating and creating global staff user page by request. [[m:User talk:Jalexander|Questions?]]) 4152 wikitext text/x-wiki {| class="messagebox standard-talk" |- |align="center"|[[Image:Info icon.svg|50px|Comment]] |align="left" width="100%"| My name is Deniz and I'm working for the [[m:Wikimedia Foundation|Wikimedia Foundation]] as an associate during the 2010 [http://wikimediafoundation.org/wiki/Support_Wikipedia/en Fundraising Drive]. You can reach me either through email (dgultekin[[File:At_sign.svg|17px| at |link=]]wikimedia.org) or on my [[m:User talk:dgultekin|Meta talk page]]. Mini-Disclaimer: All edits made as a Community Associate to Wikimedia hosted projects will be made under [[User:dgultekin|dgultekin]]. Unless otherwise stated, all edits made as [[User:dmgultekin|dmgultekin]] are made as a regular member of the community, and not a legal or official action of the Community Department of the Wikimedia Foundation. |} '''Contact Info'''<br> [[Special:EmailUser/dgultekin|Email]]<br> IRC nick name: dgultekin<br> AIM: denizgultekin<br> G-chat: dmgultekin<br> Location: San Francisco, CA cfb14yy1r9kmmgh3kahmw3tyjl6bsmt Gebruiker:Hideokun 2 2225 4155 2010-10-04T11:08:32Z 180.25.213.153 Nuwe bladsy geskep met ' [[:ja:利用者:Hideokun|Hideokun]]' 4155 wikitext text/x-wiki [[:ja:利用者:Hideokun|Hideokun]] qcdqtpp5lkjti2clnlx3j537650fzyb Gebruiker:Klyman 2 2226 4156 2010-10-06T07:05:42Z Jalexander-WMF 586 ( updating and creating global staff user page by request. [[m:User talk:Jalexander|Questions?]]) 4156 wikitext text/x-wiki My name is Kelly Lyman and I am working on the 2010-2011 fundraising team for the Wikimedia Foundation. This account is used for official edits while officially employed by the Wikimedia Foundation. Meta user name: Klyman Freenode IRC nick name: klyman AIM: klyman, kllylymn Email: klyman@wikimedia.org fpmc6di45yw14kcy3guk6nd1nem8uwz Gebruiker:Erwin/vector.js 2 2228 6794 4158 2021-02-04T23:27:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6794 javascript text/javascript // [[:m:User:Erwin/global.js]] mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Erwin/global.js&action=raw&ctype=text/javascript'); 281bkaieaosxcl4smmex56z22y3ma9c Gebruiker:CnkALTDS/vector.js 2 2229 6789 4159 2021-02-04T23:26:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6789 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:CnkALTDS/global.js&action=raw&ctype=text/javascript'); ovkku9vyuz5y1acl10uud02g42mw2u9 Gebruiker:CnkALTDS/monobook.js 2 2230 6788 4160 2021-02-04T23:26:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6788 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:CnkALTDS/global.js&action=raw&ctype=text/javascript'); ovkku9vyuz5y1acl10uud02g42mw2u9 Gebruiker:CnkALTDS/monobook.css 2 2231 4161 2010-10-16T21:48:03Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4161 css text/css @import "http://meta.wikipedia.org/w/index.php?title=User:CnkALTDS/global.css&action=raw&ctype=text/css"; 6mp97u92l3reaomf9hc7oq12b6p2v3w Gebruiker:Ebrambot 2 2232 4162 2010-10-21T18:32:12Z Ebrahim 558 Nuwe bladsy geskep met '{{bot|Ebraminio|site=fa}}' 4162 wikitext text/x-wiki {{bot|Ebraminio|site=fa}} tmlul1xdv8el70ajjky6676lk371on5 Gebruikerbespreking:Krinkle 3 2235 4993 4167 2015-02-24T17:30:16Z Krinkle 499 Alle inhoud uit bladsy verwyder 4993 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruiker:Frozen Wind 2 2238 4170 2010-11-07T19:59:10Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4170 wikitext text/x-wiki [[m:simple:User:Frozen Wind|simplewiki]] 98xobhbsyeg0z3udlfj8a6ax3zongbf Gebruiker:EdoDodo/vector.js 2 2241 6791 4175 2021-02-04T23:27:08Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6791 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:EdoDodo/global.js&action=raw&ctype=text/javascript'); laizrkaqgbvpypx7nrgyzt0c0ibpqvt MediaWiki:Sitesupport-url 8 2242 4619 4565 2013-02-07T01:34:33Z Pgehres (WMF) 814 Updating sidebar link to use subst:CONTENTLANGUAGE 4619 wikitext text/x-wiki //donate.wikimedia.org/wiki/Special:FundraiserRedirector?utm_source=donate&utm_medium=sidebar&utm_campaign=C13_af.wikibooks.org&uselang=af me3dkwom3i6gm42lt30fkc4ls456d3m Gebruiker:Quentinv57/vector.js 2 2243 6815 4184 2021-02-04T23:31:08Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6815 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Quentinv57/global.js&action=raw&ctype=text/javascript'); jgdpjuo1eeukg8zue4hg68ie63ro6wn Gebruiker:JøMa 2 2244 4185 2011-01-03T21:02:00Z JøMa 646 Nuwe bladsy geskep met '<br /><br /><br /><br /><br /><br /><br /><br /><br /><br /> <center><font size="+20">&#091;[[:de:w:User:JøMa|ˈjøːˌmaˑ]]&#093;</font></center> <br /><br /><br /><br />...' 4185 wikitext text/x-wiki <br /><br /><br /><br /><br /><br /><br /><br /><br /><br /> <center><font size="+20">&#091;[[:de:w:User:JøMa|ˈjøːˌmaˑ]]&#093;</font></center> <br /><br /><br /><br /><br /><br /><br /><br /><br /><br /> [[de:User:JøMa]] 4np28gvw186v70pwlrryip4ktdi1kbn Gebruiker:Wdwd 2 2245 4186 2011-01-09T18:02:38Z Wdwd 544 Init 4186 wikitext text/x-wiki [[:de:Benutzer:Wdwd]] bg7sr3mm7sxy0py8n7i00q1585q6rtu Gebruiker:Hydriz 2 2247 4806 4451 2014-01-21T07:14:59Z Hydriz 625 Updating global user page 4806 wikitext text/x-wiki {{#babel:en-N|zh-hans-N|zh-hant-3|af-0}} Hi, I am Hydriz. Please visit [[m:User:Hydriz|my userpage on Meta]] for more information about me. == Wiki statistics == {| class="wikitable" |- | Number of pages || {{NUMBEROFPAGES}} |- | Number of articles || '''{{NUMBEROFARTICLES}}''' |- | Number of uploaded files || {{NUMBEROFFILES}} |- | Number of registered users || {{NUMBEROFUSERS}} |- | Number of active users || {{NUMBEROFACTIVEUSERS}} |- | Number of admins || {{NUMBEROFADMINS}} |- | Number of total edits || {{NUMBEROFEDITS}} |} ngc8h35qg7lh2hrbex4rorkrsrs49yp Gebruiker:TeleComNasSprVen/monobook.js 2 2248 6821 4190 2021-02-04T23:32:08Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6821 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:TeleComNasSprVen/global.js&action=raw&ctype=text/javascript'); osyd1yf7zdjqmnb179w0iykwnnqi0m7 Gebruiker:TeleComNasSprVen/vector.js 2 2249 6822 4191 2021-02-04T23:32:18Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6822 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:TeleComNasSprVen/global.js&action=raw&ctype=text/javascript'); osyd1yf7zdjqmnb179w0iykwnnqi0m7 Gebruiker:Silver Spoon/vector.js 2 2250 6818 4192 2021-02-04T23:31:38Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6818 javascript text/javascript mw.loader.load('https://meta.wikimedia.org/w/index.php?title=User:Silver_Spoon/global.js&action=raw&ctype=text/javascript'); 34r354qe3hhq0v6nmgc8guevfchfjcc Gebruiker:Ainali 2 2251 4194 2011-02-04T01:39:43Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4194 wikitext text/x-wiki <div style="text-align:center; font-family:Arial; font-size:1.6em; color:#222;" class="plainlinks"><div style="padding:9px; background:#EEF; border:3px solid #2F2F4F; -moz-border-radius:8px; -webkit-border-radius:8px; border-radius:8px;">'''Please use one of the following links to discuss with me.'''</div><div style="margin:1px; padding:9px; background:#EEF; border:3px solid #2F2F4F; -moz-border-radius:8px; -wekbit-border-radius:8px; border-radius:8px;">'''[[m:sv:user:Ainali|Swedish Wikipedia]] | [[commons:user:Ainali|Commons]] | [[m:user:Ainali|Meta]]'''</div> 7iexk7no4c3gul7thm0jwog7u07evly Gebruiker:Shanel 2 2257 4201 2011-02-23T04:30:21Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]])♥ 4201 wikitext text/x-wiki Hello! My name is Shanel Kalicharan. My edits on this wiki are mostly part of my [[m:steward|steward work]]. If you have any comments or questions, please let me know on [[m:User talk:Shanel|my global talk page]]! 539e2stnb09ajwpzc24v9hl0lll9mz2 Gebruikerbespreking:Wutsje 3 2258 4202 2011-02-26T14:07:04Z Wutsje 318 talk page 4202 wikitext text/x-wiki * My talk page on Meta is [[:m:User_talk:Wutsje|here]]. gl8sm2br7l7tlrx354ekmuajyclrwzk Gebruiker:מתניה 2 2259 4204 2011-03-03T14:48:07Z PeterSymonds 685 [[Gebruiker:מתניה]] geskuif na [[Gebruiker:Matanya]]: Bladsy is outomaties geskuif met die wysiging van die gebruiker "[[User:מתניה|מתניה]]" na "[[User:Matanya|Matanya]]" 4204 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Matanya]] tj602cpve17e84unsw56w6ac6tv61ud Gebruiker:ChristianH 2 2261 4211 2011-03-24T17:39:06Z ChristianH 457 Nuwe bladsy geskep met 'I'm a Brazilian editor and member of Wikipedia since April 2008.<br><span class="plainlinks">[http://toolserver.org/~vvv/sulutil.php?user=ChristianH SUL account status]</spa...' 4211 wikitext text/x-wiki I'm a Brazilian editor and member of Wikipedia since April 2008.<br><span class="plainlinks">[http://toolserver.org/~vvv/sulutil.php?user=ChristianH SUL account status]</span> Contact: *<span class="plainlinks">[http://pt.wikipedia.org/w/index.php?title=Usu%C3%A1rio_Discuss%C3%A3o:ChristianH&action=edit&section=new My talk page in pt.wikipedia]</span> *[[Special:EmailUser/ChristianH|E-mail]] 7ajbf728u6emz3ar8xsrrpkd4wgqu5f Gebruiker:Pmlineditor/common.js 2 2263 4215 2011-04-03T22:25:22Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4215 javascript text/javascript mw.loader.load('http://meta.wikimedia.org/w/index.php?title=User:Pmlineditor/global.js&action=raw&ctype=text/javascript'); gyuhr8v12ygxls5m04kxh9k7cjmw19w Gebruiker:Soenke Rahn 2 2264 4216 2011-04-04T13:50:40Z Soenke Rahn 706 Nuwe bladsy geskep met 'Compare: [http://de.wikipedia.org/wiki/Benutzer:Soenke_Rahn My German User Site] Please place questions on [http://de.wikipedia.org/wiki/Benutzer_Diskussion:Soenke_Rahn My G...' 4216 wikitext text/x-wiki Compare: [http://de.wikipedia.org/wiki/Benutzer:Soenke_Rahn My German User Site] Please place questions on [http://de.wikipedia.org/wiki/Benutzer_Diskussion:Soenke_Rahn My German Talk Page] --[[Gebruiker:Soenke Rahn|Soenke Rahn]] 13:50, 4 April 2011 (UTC) bjj2epn3ljo2hjf3tormxyol4ujmbx9 Gebruiker:Philippe (WMF) 2 2265 4217 2011-04-14T04:17:47Z Jalexander-WMF 586 creating and updating global user pages for WMF Staff member upon request ([[m:User:Jalexander|Questions?]]) 4217 wikitext text/x-wiki __NOTOC__ {| " style="width:90%; margin: 0 auto 1em auto; padding: 0.2em; border: 1px solid #AAA; background: #F9F9F9;;" |- | style="padding: 0 4px;" rowspan="3" | [[Image:achtung.svg|40px|]] | '''Since July, 2009 I have worked at Wikimedia Foundation, and I'm presently Head of Reader Relations at the foundation. All edits made before my start date were in my individual, personal capacity as a volunteer, administrator, or otherwise regular member of the community – not as an employee, representative, or agent of Wikimedia Foundation.''' |} <center>''''' "Have you ever skied at Jackson Hole in Wyoming? <br /> '''''Well, there is a sign at the top of the mountain that is both enthralling and terrifying:<br /> ''''''Our mountain is like nothing you have skied before! <br /> '''''Give this mountain the special respect it demands!' <br /> '''''Wikimedia is that mountain." <br /> '''''-- Stu West, WMF Board, in [http://blogs.harvardbusiness.org/cs/2009/09/one_fine_winter_saturday_in.html discussing Wikimedia Strategic Planning]'''''</center> ==On Wiki== I am the Head of Reader Relations for the Wikimedia Foundation. My role is to represent, on the staff, the voice and needs of the vast majority of the users of Wikimedia projects: the readers who rarely or never edit. I can be reached via email at philippe[[File:At_sign.svg|17px| at |link=]]wikimedia.org or [[m:User:Philippe (WMF)|on my meta talk page]]. In my volunteer capacity, I can usually be found on en:Wikipedia or meta, where I am an elected administrator. I previously was, by virtue of my job, a bureaucrat on the [[strategy:Main Page|Wikimedia Strategic Planning wiki]]. I was a member of the election committee for the Board of Trustees in 2007, 2008, and 2009, and am the staff liaison to the committee for 2011. You can find me on en:Wikipedia as [[:en:User:Philippe|Philippe]] as a volunteer, or as [[:en:User:Philippe (WMF)|Philippe (WMF)]] in my staff role. On IRC, my username is usually Philippe. Follow me on identi.ca and Twitter! My username is philippewiki in both places. qy7h3wg0deju954bwkhedjsxsjszyah Gebruiker:Micki/common.js 2 2266 4441 4219 2012-03-11T12:36:37Z Quentinv57 577 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4441 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Micki/global.js&action=raw&ctype=text/javascript'); 8pvfaoxz0sncj1pwvqnhfwfzc9pdley Gebruiker:Micki 2 2267 4220 2011-04-16T19:31:17Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4220 wikitext text/x-wiki [[m:sr:User:Micki|wikipedia]] - [[m:User:Micki|meta]] - [[commons:User:Micki|commons]] r4ik3s0amh46fub8w3k4m5qethfd1w9 Gebruiker:FalconL 2 2270 4223 2011-04-16T22:49:02Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4223 wikitext text/x-wiki See [[m:User:FalconL|my user page on Meta]] for further information. Please also use [[m:User Talk:FalconL|my talk page there]] to contact me. l6oflce43odm57fezh9j2t3g3waofl6 Gebruiker:Avicennasis 2 2273 4226 2011-04-21T01:51:00Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4226 wikitext text/x-wiki [[m:User:Avicennasis]] {| class="wikitable" ! Maintenance ([{{fullurl:User:Avicennasis|action=purge}} purge]) ! Entries |- {{#ifexpr:{{PAGESINCAT:Candidates for speedy deletion}} > 0 | style="background:#fbb;" }} | [[:Category:Candidates for speedy deletion|Candidates for speedy deletion]] | {{PAGESINCAT:Candidates for speedy deletion}} |- |colspan="2"| [[Special:ShortPages]] |- |colspan="2"| [[Special:BrokenRedirects]] |- |colspan="2"| [[Special:DoubleRedirects]] |} [[File:IM IN UR WIKI RVRTING UR EDITS lolcat.jpg|450px]] gsqib5y2p7s3xzc3tfwug3srkad9krp Gebruiker:Wangxuan8331800 2 2274 4559 4340 2012-09-03T02:21:52Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Wangxuan8331800]]) 4559 wikitext text/x-wiki {{#babel:zh-N|en-1|af-0}} [[File:Redirectltr.png|link=]]<span class="redirectText" id="softredirect">[[w:zh:User:Wangxuan8331800]]</span><br /><span style="font-size:85%; padding-left:52px;">[[meta:Help:Redirect|{{int:redirectpagesub}}]]</span> du6spw2b8j2mwv1zr4pv7ac5no0qi1r Gebruiker:Wayiran 2 2275 4228 2011-04-30T11:19:22Z Wayiran 714 Nuwe bladsy geskep met '{{Babel|fa|en-3|az-1|ar-1|fr-1|ru-1}} ''The nature is pleased to nature,'' ''The nature overcomes the nature,'' ''The nature dominated nature.'' :[[w:Ostanes|Ostanes]]' 4228 wikitext text/x-wiki {{Babel|fa|en-3|az-1|ar-1|fr-1|ru-1}} ''The nature is pleased to nature,'' ''The nature overcomes the nature,'' ''The nature dominated nature.'' :[[w:Ostanes|Ostanes]] 4kl1eeuvzp7wbmy0y2acn3i1vwug6ki Gebruiker:Cekli829 2 2276 4792 4229 2014-01-04T18:13:00Z Cekli829 642 4792 wikitext text/x-wiki {{DISPLAYTITLE:<span style="font-family: 'Raceway'"><span style="display:none;">User:</span>Cekli</font><font color="blue">8</font><font color="red">2</font><font color="green">9</font></span>}} {| cellpadding="10" cellspacing="8" style="width: 100%; background-color: black; border: 5px solid gray; vertical-align: top; -moz-border-radius-topleft: 8px; -moz-border-radius-bottomleft: 8px; -moz-border-radius-topright: 8px; -moz-border-radius-bottomright: 8px;" | colspan="2" style="padding: 0;" | <FONT color=#ffeecc>Təkliflərinizi <B>cekli829@gmail.com</B> ünvanına göndərə bilərsiniz.</FONT> :<FONT color=#ffeecc>Digər əlaqə vasitələri:</FONT> :'''[https://www.facebook.com/tarkhan.pashazade Facebook (profile)]''' :'''[https://www.facebook.com/pages/T%C9%99rxan-Pa%C5%9Fazad%C9%99/529113383837101?ref=hl Facebook (page)]''' :'''[https://twitter.com/Cekli829 Twitter]''' :'''[http://www.youtube.com/user/Cekli829/videos YouTube]''' [[az:İstifadəçi:Cekli829]] mkbif9vqlux1n86yhyjayiv2ut8ui2l Gebruiker:Thehelpfulone/common.js 2 2280 4467 4233 2012-04-08T18:47:20Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Thehelpfulone]]) 4467 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Thehelpfulone/global.js&action=raw&ctype=text/javascript'); 90o0j49y1bc5ojh2qz4bpul8v2bl78l Gebruiker:RajeshPandey 2 2283 4236 2011-05-17T15:25:55Z RajeshPandey 735 Nuwe bladsy geskep met '[[ne:User:RajeshPandey]] [[:ne:User:RajeshPandey]]' 4236 wikitext text/x-wiki [[ne:User:RajeshPandey]] [[:ne:User:RajeshPandey]] 6s11c2sdm017ci1k78ulo2p358jf8yv Gebruikerbespreking:RajeshPandey 3 2284 4237 2011-05-17T15:26:58Z RajeshPandey 735 Nuwe bladsy geskep met ' [[:ne:User:RajeshPandey]]' 4237 wikitext text/x-wiki [[:ne:User:RajeshPandey]] 8m49yqpyi3wplx8uhukzzuxmx9t2okw Gebruiker:Vigorous action 2 2285 4288 4287 2011-08-28T10:20:08Z Vigorous action 365 4288 wikitext text/x-wiki [[meta:user:vigorous action|Vigorous action]]/[[w:ja:user:vigorous_action|home]] [[sulutil:Vigorous_action|SUL]] 5cyluc67zjj9mesgz28ivcb9sxzwqsi Gebruiker:Christine (WMF) 2 2287 4240 2011-05-27T17:47:13Z Jalexander-WMF 586 creating and updating global user pages for WMF Staff member upon request ([[m:User:Jalexander|Questions?]]) 4240 wikitext text/x-wiki <div style="text-align:center;">''Never doubt that a small group of thoughtful, committed citizens can change the world.'' ''Indeed, it is the only thing that ever has.'' ''-- [[w:en:Margaret Mead|Margaret Mead]]''</div> ==Who I Am== I work in Reader Relations for the Wikimedia Foundation. I have a background in online community management, and am currently a Master's candidate at [[w:en:San Jose State University|San Jose State University]] in [[w:en:Applied anthropology|Applied anthropology]]. My thesis topic revolves around stakeholder relations in Web 2.0, using [[w:en:LiveJournal|LiveJournal]] as my fieldsite. I am analyzing how communications occur, how they break down, and where the failures in communication occur. I hope to use this information to be able to assist organizations with interfacing better with their online communities; not seeing them as simple consumers to be sold a product to, but instead as partners and true stakeholders in their operations. My volunteer account is [[w:en:User:Kethryvis|Kethryvis]], which I use sporadically usually on small edits on interesting subjects that generally have nothing to do with my scholarly interests. It's what keeps me sane. I also have an alternate account, [[w:en:User:Kheff|Kheff]] in order to see what the registration process is like for new editors. This account will make few, if any, edits and will be abandoned once this research is complete. If you'd like to find me on IRC, I hang out under the nick ChristineM. Very original, I know. You can email me with any questions or comments to readers[[File:At sign.svg|15px|&#xFE6B;|link=]]wikimedia.org ==What I'm Thinking About== I'm thinking about how to make the new editor process easier. I'm fairly new at editing myself, and it's rather daunting. There's an awful lot to wade through. There's gotta be an easier way! (one of my mantras) I'm thinking about the line between WMF staff and Wiki-volunteers. Where they cross, where they clash, where they come together. Hey wait, that sounds familiar. I'm thinking about all the on-Wiki and off-Wiki reading I need to do to get up to speed! [[Category:Wikimedia Foundation staff]] 31qadww7yza09dy2xxjlf6ru4wdxmvb Gebruiker:Beria 2 2288 4447 4241 2012-03-21T17:07:01Z Hoo User Page Bot 827 Creating global user page, per request 4447 wikitext text/x-wiki <!--- Page title ---> <div style="position:absolute; z-index:100; right:45px; top:10px;" class="metadata"><small>''[[:pt:s:A minha pátria é a língua portuguesa|'''A minha pátria é a língua portuguesa!''']]''</small></div><div style="position:absolute; z-index:100; right:10px; top:10px;" class="metadata">[[File:Flags of Brazil and Portugal.svg|30px|link=:pt:CLPC]]</div></div> <!--- Page style background ---> {| style="width: 100%; background-color: #e2e7f7; border: 2px solid #4888aa; -moz-border-radius:15px; vertical-align: top;" | colspan="2" style="cellpadding=8; cellspacing=8" | <!-- Qoute section --> |- | style="background-color: #EFF8FF; border: 1px solid #8888aa; -moz-border-radius:15px; border-right-width:4px; border-bottom-width:4px; vertical-align: top;" colspan="2"| {| style="margin:auto; border-collapse:collapse; border-style:none; background-color:transparent; width:100% ; {{#if: | border: 1px solid #AAAAAA;}}" class="cquote" | width="20" valign="top" style="color:#B2B7F2;font-size:35px;font-family:'Times New Roman',serif;font-weight:bold;text-align:left;padding:10px 10px;" | “ | valign="top" style="padding:4px 10px;" | <div style="font-family:'Palatino Linotype'; font-style: italic; font-size:16px">No man is an island entire of itself; every man is a piece of the continent, a part of the main; if a clod be washed away by the sea, Europe is the less, as well as if a promontory were, as well as any manner of thy friends or of thine own were; any man's death diminishes me, because I am involved in mankind. And therefore never send to know for whom the bell tolls; it tolls for thee. | width="20" valign="bottom" style="color:#B2B7F2;font-size:36px;font-family:'Times New Roman',serif;font-weight:bold;text-align:right;padding:10px 10px;" | ” |- | colspan="3" style="padding-right: 4%" | <p style="font-size:smaller;text-align: right"><cite style="font-style:normal;">—[[:en:John Donne|John Donne]] in [[:s:Meditation_VII|''Meditation VII'']].</cite></p> |} <!-- Description section --> |- | style="width: 78%; background-color: #EFF8FF; border: 1px solid #8888aa; -moz-border-radius:15px; -moz-border-radius:15px; border-right-width:4px; border-bottom-width:4px; vertical-align: top;" rowspan="2"| <div style= text-align: justify;"> '''Name:''' <font color="#6495ED" size="5" face="Edwardian Script ITC" > Béria Lima </font> (Nickname: <font size="5" face="Edwardian Script ITC">Beh</font>) '''In Wikimedia Projects since:''' ''5 October, 2007'' (''{{#if:|{{ontem hoje amanhã|{{#expr: + {{#expr: <!--Days from all years past:--> + (({{CURRENTYEAR}} - 1) * 365) + ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 4)) / 4) <!--add a day for every leap--> - ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 100)) / 100) <!--subtract 100 year exception--> + ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 400)) / 400) <!--readd 400 year exception--> <!--Days so far this year:--> + {{ #ifexpr: <!--add days for past months this year--> <!--Gives 1 or 2 extra days because of February--> ({{CURRENTMONTH}} - 1) < 8 | ( ({{CURRENTMONTH}} - 1) * 30.5 round 0) | ( ({{CURRENTMONTH}} - 1) * 30.5 + 0.9 round 0 ) }} - {{ #ifexpr: ({{CURRENTMONTH}} <= 2) | 0 | {{ #ifexpr: <!-- if leap year --> ({{CURRENTYEAR}} / 4) = ({{CURRENTYEAR}} / 4 round 0) <!--If divisible by 4--> and ({{CURRENTYEAR}} / 100 != {{CURRENTYEAR}} / 100 round 0) <!--and not by 100--> | 1 | 2 }} }} + {{ #ifexpr: ({{CURRENTMONTH}} <= 2) | 0 | {{ #ifexpr: <!--400 year exception--> ({{CURRENTYEAR}} / 400) = ({{CURRENTYEAR}} / 400 round 0) | 1 | 0 }} }} + {{CURRENTDAY}} }}{{#ifexpr: {{CURRENTYEAR}} < 1 | _ERROR - Can not handle dates before January 1, 1 A.D. }} - {{#expr: <!--Days from all years past:--> + ((2007 - 1) * 365) + (((2007 - 1) - ((2007 - 1) mod 4)) / 4) <!--add a day for every leap--> - (((2007 - 1) - ((2007 - 1) mod 100)) / 100) <!--subtract 100 year exception--> + (((2007 - 1) - ((2007 - 1) mod 400)) / 400) <!--readd 400 year exception--> <!--Days so far this year:--> + {{ #ifexpr: <!--add days for past months this year--> <!--Gives 1 or 2 extra days because of February--> (10 - 1) < 8 | ( (10 - 1) * 30.5 round 0) | ( (10 - 1) * 30.5 + 0.9 round 0 ) }} - {{ #ifexpr: (10 <= 2) | 0 | {{ #ifexpr: <!-- if leap year --> (2007 / 4) = (2007 / 4 round 0) <!--If divisible by 4--> and (2007 / 100 != 2007 / 100 round 0) <!--and not by 100--> | 1 | 2 }} }} + {{ #ifexpr: (10 <= 2) | 0 | {{ #ifexpr: <!--400 year exception--> (2007 / 400) = (2007 / 400 round 0) | 1 | 0 }} }} + 8 }}{{#ifexpr: 2007 < 1 | _ERROR - Can not handle dates before January 1, 1 A.D. }} }} }}|{{#expr:+ {{#expr: <!--Days from all years past:--> + (({{CURRENTYEAR}} - 1) * 365) + ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 4)) / 4) <!--add a day for every leap--> - ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 100)) / 100) <!--subtract 100 year exception--> + ((({{CURRENTYEAR}} - 1) - (({{CURRENTYEAR}} - 1) mod 400)) / 400) <!--readd 400 year exception--> <!--Days so far this year:--> + {{ #ifexpr: <!--add days for past months this year--> <!--Gives 1 or 2 extra days because of February--> ({{CURRENTMONTH}} - 1) < 8 | ( ({{CURRENTMONTH}} - 1) * 30.5 round 0) | ( ({{CURRENTMONTH}} - 1) * 30.5 + 0.9 round 0 ) }} - {{ #ifexpr: ({{CURRENTMONTH}} <= 2) | 0 | {{ #ifexpr: <!-- if leap year --> ({{CURRENTYEAR}} / 4) = ({{CURRENTYEAR}} / 4 round 0) <!--If divisible by 4--> and ({{CURRENTYEAR}} / 100 != {{CURRENTYEAR}} / 100 round 0) <!--and not by 100--> | 1 | 2 }} }} + {{ #ifexpr: ({{CURRENTMONTH}} <= 2) | 0 | {{ #ifexpr: <!--400 year exception--> ({{CURRENTYEAR}} / 400) = ({{CURRENTYEAR}} / 400 round 0) | 1 | 0 }} }} + {{CURRENTDAY}} }}{{#ifexpr: {{CURRENTYEAR}} < 1 | _ERROR - Can not handle dates before January 1, 1 A.D. }} - {{#expr: <!--Days from all years past:--> + ((2007 - 1) * 365) + (((2007 - 1) - ((2007 - 1) mod 4)) / 4) <!--add a day for every leap--> - (((2007 - 1) - ((2007 - 1) mod 100)) / 100) <!--subtract 100 year exception--> + (((2007 - 1) - ((2007 - 1) mod 400)) / 400) <!--readd 400 year exception--> <!--Days so far this year:--> + {{ #ifexpr: <!--add days for past months this year--> <!--Gives 1 or 2 extra days because of February--> (10 - 1) < 8 | ( (10 - 1) * 30.5 round 0) | ( (10 - 1) * 30.5 + 0.9 round 0 ) }} - {{ #ifexpr: (10 <= 2) | 0 | {{ #ifexpr: <!-- if leap year --> (2007 / 4) = (2007 / 4 round 0) <!--If divisible by 4--> and (2007 / 100 != 2007 / 100 round 0) <!--and not by 100--> | 1 | 2 }} }} + {{ #ifexpr: (10 <= 2) | 0 | {{ #ifexpr: <!--400 year exception--> (2007 / 400) = (2007 / 400 round 0) | 1 | 0 }} }} + 5 }}{{#ifexpr: 2007 < 1 | _ERROR - Can not handle dates before January 1, 1 A.D. }} }} }}'' days) __NOTOC__ == My home(s) == [[File:Ponte D. Luís, Sé e Jardim do Morro vistos de Gaia.JPG|center|thumb|450px|[[:pt:Sé do Porto|Porto Cathedral]], [[:pt:Ponte Dom Luís I|Dom Luis I bridge]] and [[:pt:Serra do Pilar|Serra do Pilar Monastery]], 3 postcards of [[:en:Oporto|my town]].]] [[File:Recife 2005 JAN 25 AncientAndModernCenter.jpg|center|thumb|450px|The new and the [[:en:Recife Antigo|old Recife]].]] == Quotes == {| style="margin:auto; border-collapse:collapse; border-style:none; background-color:transparent; width:{{#if: | 100% | auto}}; {{#if: | border: 1px solid #AAAAAA;}}" class="cquote" | width="20" valign="top" style="color:#B2B7F2;font-size:35px;font-family:'Times New Roman',serif;font-weight:bold;text-align:left;padding:10px 10px;" | “ | valign="top" style="padding:4px 10px;" | <div style="font-family:'Palatino Linotype'; font-style: italic; font-size:16px">La pensée est le labeur de l’intelligence, la rêverie en est la volupté. | width="20" valign="bottom" style="color:#B2B7F2;font-size:36px;font-family:'Times New Roman',serif;font-weight:bold;text-align:right;padding:10px 10px;" | ” |- | colspan="3" style="padding-right: 4%" |<p style="font-size:smaller;text-align: right"><cite style="font-style:normal;">—[[:fr:Victor Hugo|Victor Hugo]] in [[:fr:Les Miserables|''Les Miserables'']].</cite></p> |} {| style="margin:auto; border-collapse:collapse; border-style:none; background-color:transparent; width:{{#if: | 100% | auto}}; {{#if: | border: 1px solid #AAAAAA;}}" class="cquote" | width="20" valign="top" style="color:#B2B7F2;font-size:35px;font-family:'Times New Roman',serif;font-weight:bold;text-align:left;padding:10px 10px;" | “ | valign="top" style="padding:4px 10px;" | <div style="font-family:'Palatino Linotype'; font-style: italic; font-size:16px">There is in fact a heroism of virtue in the pride of this woman, who resists every seduction, the impulses of his own passion as well as the rapture of the senses</div> | width="20" valign="bottom" style="color:#B2B7F2;font-size:36px;font-family:'Times New Roman',serif;font-weight:bold;text-align:right;padding:10px 10px;" | ” |- |colspan="3" style="padding-right: 4%" | <p style="font-size:smaller;text-align: right"><cite style="font-style:normal;">—[[:w:José de Alencar|José de Alencar]], in [[:s:pt:Senhora|''Senhora'']].</cite></p> |} {| style="margin:auto; border-collapse:collapse; border-style:none; background-color:transparent; width:{{#if: | 100% | auto}}; {{#if: | border: 1px solid #AAAAAA;}}" class="cquote" | width="20" valign="top" style="color:#B2B7F2;font-size:35px;font-family:'Times New Roman',serif;font-weight:bold;text-align:left;padding:10px 10px;" | “ | valign="top" style="padding:4px 10px;" | <div style="font-family:'Palatino Linotype'; font-style: italic; font-size:16px">Der Irrtum ist viel leichter zu erkennen, als die Wahrheit zu finden; jener liegt auf der Oberfläche, damit läßt sich wohl fertig werden; diese ruht in der Tiefe, danach zu forschen ist nicht jedermanns Sache. | width="20" valign="bottom" style="color:#B2B7F2;font-size:36px;font-family:'Times New Roman',serif;font-weight:bold;text-align:right;padding:10px 10px;" | ” |- | colspan="3" style="padding-right: 4%" |<p style="font-size:smaller;text-align: right"><cite style="font-style:normal;">—[[:de:Johann Wolfgang von Goethe|Johann Wolfgang von Goethe]] in [[:de:Maximen und Reflexionen|''Maximen und Reflexionen'']].</cite></p> |} == Other accounts == * [[:pt:User:Lucia Bot|Lucia Bot]] * [[User:Ripchip Bot|Ripchip Bot]] == [[:commons:Category:Images sent by Béria Lima|My pictures]] == <div style="width: 100%; -moz-column-count: 2;"> ; Pictures taken by me * [[:commons:Category:Files from Brazil by Béria Lima|Files from Brazil]] * [[:commons:Category:Files from Portugal by Béria Lima|Files from Portugal]] :* [[:commons:Category:Files from Aveiro by Béria Lima|Files from Aveiro]] :* [[:commons:Category:Files from Braga by Béria Lima|Files from Braga]] :* [[:commons:Category:Files from Lisboa by Béria Lima|Files from Lisbon]] :* [[:commons:Category:Files from Porto by Béria Lima|Files from Oporto]] :* [[:commons:Category:Files from Sintra by Béria Lima|Files from Sintra ]] * [[:commons:Category:Files from Spain by Béria Lima|Files from Spain]] ; Files uploaded by me * [[:commons:Category:Files from Flickr uploaded by Béria Lima|Files from Flickr]] :* [[:commons:Category:Files of Lisboa uploaded by Béria Lima|Files of Lisbon from Flickr]] :* [[:commons:Category:Files of Porto uploaded by Béria Lima|Files of Oporto from Flickr]] * [[:commons:Category:Files from Wikimedia projects uploaded by Béria Lima|Files from Wikimedia projects]] ; Pictures of me * [[:commons:Category:Béria Lima|Béria Lima]] (the category) </div> == Other Wikimedia projects == <!--- Projetos Correlatos! rsrs -----------> <div style="clear:both;"></div> <center> {| class="toccolours" | style="background:#d3d3d3;color:#a52a2a text-align:center;width:100%;" colspan="14" | <big style="font-size:110%;"><center>'''My [[:en:WP:UP|User pages]] in other wiki projects'''</center></big> |- | valign="middle" bgcolor="ffffff" | <center>[[image:Wikipedia-logo-pt.png|60px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Wikipedia-logo-en.png|60px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Commons-logo.svg|50px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Wikiquote-logo.png|50px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Wikinews-logo.svg|50px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Wikisource-logo.svg|50px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[image:Wikibooks-logo.png|60px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[Image:Wiktionary-logo-pt.png|60px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[Image:Wikiversity-logo.svg|60px]]</center> | valign="middle" bgcolor="ffffff" | <center>[[Image:Test wiki logo.png|60px]]</center> |- <!-- Páginas de Usuário --> | valign="middle" bgcolor="d3d3d3" | <center>'''[[:w:pt:User:Beria|((pt)) Wikipedia]]''' | valign="middle" bgcolor="d3d3d3" | <center>[[:en:User:Beria|((en)) Wikipedia]] | valign="middle" bgcolor="d3d3d3" | <center>[[commons:User:Beria|Commons]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:q:Usuário:Beria|Wikiquote]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:n:Usuário:Beria|Wikinews]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:s:Usuário:Beria|Wikisource]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:b:Usuário:Beria|Wikibooks]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:wikt:Usuário:Beria|Wikcionário]] | valign="middle" bgcolor="d3d3d3" | <center>[[:pt:v:Usuário:Beria|Wikiversidade]] | valign="middle" bgcolor="d3d3d3" | <center><span class="plainlinks">[http://test.wikipedia.org/wiki/User:Beria Test Wiki] |- |} <!--- Fim dos Projetos Correlatos! rsrs -----------> <br style="clear:both" /> </div><!-- END OF MAIN BOX START OF TOP RIGHT-FLOAT BOX (portrait)--> <!-- Image section --> | style="width: 20%; background-color: #EFF8FF; border: 1px solid #8888aa; -moz-border-radius:15px; border-right-width:4px; border-bottom-width:4px; vertical-align: top;" rowspan="1"| [[Image:Spleen et ideal.jpg|220px|center|thumb|'''Spleen et Ideal'''<br /><p style="font-size:smaller;text-align: right">by Carlos Schwabe</p>]] <!-- Userboxes section --> |- | style="width: 20%; background-color: #EFF8FF; border: 1px solid #8888aa; -moz-border-radius:15px; border-right-width:4px; border-bottom-width:4px; vertical-align: top; text-align: center; height: 10px;" rowspan="2"| {| [[Image:Crystal Clear app package.png|35px]] <big>'''Userboxes'''</big> <!--- Babel --> {{#babel:pt-N|en-3|es-2|ca-2|gl-2|mwl-2|fr-1|it-1|an-1|oc-1}} <!-- Other userboxes --> <!-- Meta Adm box --> <div style="float:center; border:1px solid #999; margin:1px; width:238px"> {| cellspacing="0" style="width:238px; background:#EEE;" | style="width:45px; height:45px; background:#DDD; text-align:center; font-size:14pt; color:black;" | '''[[File:Wikimedia Community Logo.svg|40 px]]''' | style="font-size:8pt; padding:4pt; line-height:1.25em; color:#000;" | This user is an [[Meta:Administrators|administrator]] on Meta-Wiki. <small>(<span class="plainlinks">[{{fullurl:Special:Listusers|limit=1&username={{PAGENAMEE}} verify}}]</span>)</small> |}</div> <!-- Commons Adm box --> <div style="float:center; border:1px solid #999; margin:1px; width:238px"> {| cellspacing="0" style="width:238px; background:#EEE;" | style="width:45px; height:45px; background:#DDD; text-align:center; font-size:14pt; color:black;" | '''[[File:Commons-logo.svg|40 px]]''' | style="font-size:8pt; padding:4pt; line-height:1.25em; color:#000;" | This user is an [[:commons:Commons:Administrators|administrator]] on Commons. <small>(<span class="plainlinks">[{{fullurl:commons:Special:Listusers|limit=1&username={{PAGENAMEE}} verify}}]</span>)</small> |}</div> <!-- Strategy Adm box --> <div style="float:center; border:1px solid #999; margin:1px; width:238px"> {| cellspacing="0" style="width:238px; background:#EEE;" | style="width:45px; height:45px; background:#DDD; text-align:center; font-size:14pt; color:black;" | '''[[File:Wikimedia Community Logo.svg|40 px]]''' | style="font-size:8pt; padding:4pt; line-height:1.25em; color:#000;" | This user is an [[:strategy:Commons:Administrators|administrator]] on Strategy-Wiki. <small>(<span class="plainlinks">[{{fullurl:strategy:Special:Listusers|limit=1&username={{PAGENAMEE}} verify}}]</span>)</small> |}</div> <!-- Wikimedia Portugal --> <div class="TemplateBUser" style="float:center; margin:1px; width:238px; border:1px solid #006300;"> {| border="0" cellspacing="0" cellpadding="1" style="background-color:#ffffff; color:#000000; width:100%;" |- |class="TemplateBUserLeft" style="width:45px; height:45px; background-color:#FFFFFF; color:#000000; text-align:center; vertical-align:middle;"| [[Image:Wikimedia Portugal logo 135px.png|45px|Wikimedia Portugal logo 135px.png]] |class="TemplateBUserInfo" style="padding:1px 4px; vertical-align:middle;"| <div class="plainlinks TemplateBUserText" style="font-size:0.83em; direction:ltr; line-height:1.25;">Este utilizador é membro da [http://www.wikimedia.pt/ Wikimedia Portugal].</div> |}</div> <!-- Wikimedia Argentina --> <div class="TemplateBUser" style="float:center; margin:1px; width:238px; border:1px solid #006300;"> {| border="0" cellspacing="0" cellpadding="1" style="background-color:#ffffff; color:#000000; width:100%;" |- |class="TemplateBUserLeft" style="width:45px; height:45px; background-color:#FFFFFF; color:#000000; text-align:center; vertical-align:middle;"| [[File:Wikimedia Argentina logo.svg|45px|Wikimedia Argentina logo.svg]] |class="TemplateBUserInfo" style="padding:1px 4px; vertical-align:middle;"| <div class="plainlinks TemplateBUserText" style="font-size:0.83em; direction:ltr; line-height:1.25;">This user is member of [http://www.wikimedia.org.ar/ Wikimedia Argentina].</div> |}</div> <!-- IRC user --> <div style="float: center; width: 238px; border: solid #1E90FF 1px; margin: 1px;"> {| cellspacing="0" style="width: 238px; color:#000000; background: #000000;" | style="width: 45px; height: 45px; background: #77aaff; text-align: center; font-size:14pt; color:#FFCC11" |[[Image:Crystal kdmconfig.png|36px]] | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; background:#bbddff" | This user's [[IRC]] nick is '''Beria''' on the server '''[[:en:Freenode|Freenode]]'''. |}</div><noinclude> <!-- Time zone --> <div style="float:center; border:1px solid #ccc; margin:1px;width:248px " class="wikipediauserbox "> {| cellspacing="0" style="width:238px; background:#fff;" | style="width:45px; height:45px; background:#ccc; text-align:center; font-size:12pt; color:black; padding:0 1px 0 0; line-height:1.25em; vertical-align: middle; " | [[Image:Nuvola apps kworldclock.png|43px|link=:en:Template:User time zone]] | style="text-align:left; font-size:8pt; padding:0 4px 0 4px; height:45px; line-height:1.25em; color:black; vertical-align: middle; " | This user's time zone is '''[[:en:UTC-3|UTC-3]]'''. |}</div> <!-- Brazil <3 Portugal --> <div style="float: center; border:solid #800 1px; margin: 1px;width:248px "> {| cellspacing="0" style="width: 240px; background: #080;" | style="width: 45px; height: 45px; background: #EEE; text-align: center; font-size: 12pt; color: #000;" | '''[[Image:Bandeira pt.gif|40px]]''' | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; color: #fff;" | This brazilian user loves '''[[Portugal|<span style="color:white">Portugal</span>]]'''. | style="width: 45px; height: 45px; background: #EEE; text-align: center; font-size: 12pt; color: #000;" | '''[[Image:Flags of Brazil and Portugal.svg|50px]]''' |}</div><div style="clear:both;"></div> |} |} rgcfkqksbnelpld0ioomnxrohwtv4o2 Gebruiker:Wikitanvir/common.js 2 2290 4249 4246 2011-06-23T06:57:56Z Wikitanvir 549 fix 4249 javascript text/javascript mw.loader.load('http://meta.wikimedia.org/w/index.php?title=User:Wikitanvir/global.js&action=raw&ctype=text/javascript'); eu57oubmqbain3535mm4utqg91i5df7 Gebruiker:Wikitanvir/common.css 2 2291 4248 4247 2011-06-23T06:53:39Z Wikitanvir 549 Global CSS 4248 css text/css @import "http://meta.wikimedia.org/w/index.php?title=User:Wikitanvir/global.css&action=raw&ctype=text/css"; rolnl57kedhql98hla27k4s2cfq1tbq Gebruiker:Dcljr 2 2292 4968 4861 2015-02-06T03:37:52Z Dcljr 627 + Admins link 4968 wikitext text/x-wiki {{#babel:en|es-1|af-0}} <div lang="en-US"> For information about me, please see [[:en:User:Dcljr]]. To discuss any issues related to ''this'' wiki, please use '''[[User talk:Dcljr|my talk page here]]'''. ''Note:'' This wiki contains {{NUMBEROFARTICLES}} book modules. ([[Special:SpecialPages|See also]]: [[Special:Statistics|Statistics]], [[Special:NewPages|NewPages]], [[Special:RecentChanges|RecentChanges]], [[Special:NewFiles|NewFiles]], [[Special:Log|Log]], [[Special:Userlist/sysop|Admins]].) </div> [[en:User:Dcljr]] 4jkfv33gsv7uj7d0ok4xiny8n51zisq Gebruiker:GlobalEditBot 2 2293 4253 2011-07-01T09:33:51Z GlobalEditBot 769 global userpage like requested [[:m:Syncbot|here]] 4253 wikitext text/x-wiki Hei! I'm GlobalEditBot nice to meet you! I work for [[user:Dirt Diver]] and my task is to create global pages like userpages, talkpages and more. When you want more information or make a request please see my [[:m:User:Dirt Diver|Meta page]]. bahiignmrw6x1lwmy6copcdlv50thql Gebruiker:Dirt Diver 2 2294 4254 2011-07-01T13:18:05Z GlobalEditBot 769 global userpage like requested [[:m:Syncbot|here]] 4254 wikitext text/x-wiki Hi, I'm Dirt Diver, the bot operator for [[:m:User:GlobalEditBot]]. Please contact me on [[:m:|Meta]] if problems will occur. qemawpdxhmp2w5nndxkqphkwjd7gpab Gebruiker:Teles 2 2295 4255 2011-07-01T16:09:26Z GlobalEditBot 769 global userpage like requested [[:m:User:Pathoschild/Scripts/Synchbot#Request_global_page_edits|here]] 4255 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT]]<span class="redirectText" id="softredirect">[[:m:user:Teles]]</span> hdsr4spn4wr4v6n75ioss6u7suyofmz Gebruiker:Vituzzu 2 2296 4256 2011-07-01T17:30:42Z Wikitanvir 549 Creating userpage per request 4256 wikitext text/x-wiki Please contact me on [[:m:User talk:Vituzzu|meta]] or [[:m:w:it:User talk:Vituzzu|Wikipedia in Italian]], you can also find some information about my activities on Wikipedia [[:m:User:Vituzzu|here]]. n1g86ogj2adv0pec093rdzxsggl3ewg Gebruiker:Reza1615/common.js 2 2297 4257 2011-07-02T01:24:53Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4257 javascript text/javascript mw.loader.load('http://meta.wikimedia.org/w/index.php?title=User:reza1615/global.js&action=raw&ctype=text/javascript'); 0mj5e981kd714jtusacoh6geqylflkp Gebruiker:MacMed 2 2298 4258 2011-07-02T03:51:05Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4258 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT]]<span class="redirectText" id="softredirect">[[m:w:en:user:MacMed]]</span> gd65qnfv2c1mq94q8pdga76cpodptu5 Gebruiker:Bencmq 2 2299 4259 2011-07-02T04:59:00Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4259 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT]]<span class="redirectText" id="softredirect">[[w:m:user:Bencmq]]</span> 5g79f363gzrklr7n8gpjo400x572e8c Gebruiker:Dawid Deutschland 2 2301 4261 2011-07-02T16:06:51Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4261 wikitext text/x-wiki * [[m:user:Dawid Deutschland|Meta]]. * [[m:ka:user:Dawid Deutschland|Georgische Wikipedia]]. * [[m:wikt:ka:user:Dawid Deutschland|Georgisches Wikiwörterbuch]]. * [[m:de:user:Dawid Deutschland|Deutsche Wikipedia]]. qkycphuqt8rmi17hd1j5tg82xcgs94j Gebruikerbespreking:Crochet.david.bot 3 2304 4264 2011-07-02T18:35:24Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4264 wikitext text/x-wiki #REDIRECT [[User_talk:Crochet.david]] 4uf0ke0pmd9gfruwsaibs9cnstjak1b Gebruiker:Addihockey10 2 2305 4265 2011-07-19T21:26:13Z Addihockey10 776 Creating global user page 4265 wikitext text/x-wiki {{DISPLAYTITLE:<span style="display:none;">User:</span><font color=red>Addi<font color=blue>hockey<font color=gold>10</font></font></font>}} <div style="position: relative; height: 1%;"> <div style="position: relative; margin: 0 -1em; padding: 0; background-color: transparent; border: none; height: 1%;"> <div style="position: relative; margin: 0 auto; width: 800px; border: none; height: 1%;"> <div style="position: relative; overflow: hidden; height: 600px;"><!-- Height of the main image --> <div style="position: relative; overflow: hidden; margin: 1000;">[[File:Flowers in my backyard {{#ifeq: {{#ifeq: {{#expr:({{NUMBEROFEDITS:R}} mod 20) + 1}}|3|20|{{#expr:({{NUMBEROFEDITS:R}} mod 20) + 1}}}}|7|1|{{#expr:({{NUMBEROFEDITS:R}} mod 20) + 1}}}}.jpg|left|900px]]</div> <div style="position: absolute; top: 0; width: 100%; height: 100%;"> <div style="margin: 1em; font-size: 100%;"> </div> <div style="position: absolute; left: 180px; top: 320px; z-index: 10; width: 300px; border: none; padding: 0.75em 1em; background-color:none; text-align:left; v-align:center;"> <span style="font-family:Times New Roman;color:white; font-size:400%;">'''''Addihockey10'''''</span></div> <div style="position: absolute; left: 130px; top: 355px; z-index: 10; width: 300px; border: none; padding: 0.75em 1em; background-color:none; text-align:left; v-align:center;"> </div> </div> </div> </div> </div> </div> <center> 47r0zg6fizf1emqp57xy5brpmdbmxj8 Gebruikerbespreking:Hội Phượng Hoàng 3 2308 4269 2011-07-21T05:12:19Z Hội Phượng Hoàng 739 Nuwe bladsy geskep met '<div style="margin: 1em 0; padding: 8px; background-color: #ffffff; border: 1px solid #ffffff; box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -moz-box-shadow: 0.1em 0....' 4269 wikitext text/x-wiki <div style="margin: 1em 0; padding: 8px; background-color: #ffffff; border: 1px solid #ffffff; box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -moz-box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -webkit-box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); border-radius: 0.3em; -moz-border-radius: 0.3em; -webkit-border-radius: 0.3em; width: auto; font-family: Segoe UI, Tahoma; font-size: 95%;"><div align="center"><big>'''Hội Phượng Hoàng''' @ [[m:User:Hội Phượng Hoàng|Meta-Wiki]] ([[m:User talk:Hội Phượng Hoàng|talk]]), @ [[commons:User:Hội Phượng Hoàng|Commons]] ([[commons:User talk:Hội Phượng Hoàng|talk]]), @ [[w:vi:User:Hội Phượng Hoàng|Vietnamese Wikipedia]] ([[w:vi:User talk:Hội Phượng Hoàng|talk]])</big></div></div> peov3ovd4gi4gikd7snc7g47rzj7syo Gebruiker:Hội Phượng Hoàng 2 2309 4270 2011-07-21T05:12:21Z Hội Phượng Hoàng 739 Nuwe bladsy geskep met '<div style="margin: 1em 0; padding: 8px; background-color: #ffffff; border: 1px solid #ffffff; box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -moz-box-shadow: 0.1em 0....' 4270 wikitext text/x-wiki <div style="margin: 1em 0; padding: 8px; background-color: #ffffff; border: 1px solid #ffffff; box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -moz-box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); -webkit-box-shadow: 0.1em 0.1em 0.75em rgba(0,132,255,0.75); border-radius: 0.3em; -moz-border-radius: 0.3em; -webkit-border-radius: 0.3em; width: auto; font-family: Segoe UI, Tahoma; font-size: 95%;"><div align="center"><big>'''Hội Phượng Hoàng''' @ [[m:User:Hội Phượng Hoàng|Meta-Wiki]] ([[m:User talk:Hội Phượng Hoàng|talk]]), @ [[commons:User:Hội Phượng Hoàng|Commons]] ([[commons:User talk:Hội Phượng Hoàng|talk]]), @ [[w:vi:User:Hội Phượng Hoàng|Vietnamese Wikipedia]] ([[w:vi:User talk:Hội Phượng Hoàng|talk]])</big></div></div> peov3ovd4gi4gikd7snc7g47rzj7syo Gebruiker:Pesare amol 2 2310 4271 2011-07-22T18:24:55Z Pesare amol 648 Nuwe bladsy geskep met '{| | style="border:solid #EFEFF1; -moz-border-radius: 10px; background:white; width:80%;" | '''<span style="font-family:verdana; font-size:10pt; color:#B05427">Hello!</span>...' 4271 wikitext text/x-wiki {| | style="border:solid #EFEFF1; -moz-border-radius: 10px; background:white; width:80%;" | '''<span style="font-family:verdana; font-size:10pt; color:#B05427">Hello!</span>''' <br> <span style="font-family:verdana; font-size:8pt; color:#626574;"> My name is Mahdi and I was born in Amol. It's situated in the North of Iran. It's in the Middle East in Asia. The main religion in my country is Islam and I'm Moslem But Other religions are Christianity, judaism and Zoroastrianism. IRAN IS MY LOVE :Pesare Amol means: Amolian Boy in English '''<span style="font-family:verdana; font-size:10pt; color:#B05427">Pesare Amol</span>''' | style="border:solid #EFEFF1; -moz-border-radius: 10px; background:white;" | [[Image:Damavand Iran.JPG|thumb|300px]] '''<span style="font-family:verdana; font-size:10pt; color:#B05427">[http://en.wikipedia.org/wiki/Damavand Damāvand] is the symbol of [http://en.wikipedia.org/wiki/iran Iranian] </span>''' <br> |} [[fa:کاربر:pesare amol]] rh05zsy4fsaeks2du7hgaktuoqo5m1t Gebruiker:Neozoon 2 2311 4272 2011-07-25T21:29:53Z Neozoon 779 1 4272 wikitext text/x-wiki Leave me a message on my home wiki http://de.wikipedia.org/wiki/Benutzer_Diskussion:Neozoon --[[Gebruiker:Neozoon|Neozoon]] 21:29, 25 Julie 2011 (UTC) 6hx4urwnsk0t9nqbf163du9hb1crl4q Overleg gebruiker:Velocitas 0 2312 4273 2011-08-03T11:24:36Z Velocitas 781 Nuwe bladsy geskep met 'Ek is nie baie aktief nie op die Afrikaanstalige Wikibooks. Jy kan kontak my op die Nederlandstalige Wikipedia. Ek het Afrikaans nie als moedertaal nie, maar Nederlands. D...' 4273 wikitext text/x-wiki Ek is nie baie aktief nie op die Afrikaanstalige Wikibooks. Jy kan kontak my op die Nederlandstalige Wikipedia. Ek het Afrikaans nie als moedertaal nie, maar Nederlands. Daarom foute kan voorkom. 5quu9dcqleoje07zm6dp4wncw3ptpmm Gebruiker:Lucia Bot 2 2315 7273 4281 2023-08-16T12:41:10Z Minorax 2092 ([[c:GR|GR]]) [[File:Crystal Clear action run.png]] → [[File:Crystal Clear action run.svg]] vva 7273 wikitext text/x-wiki {| class="infobox" style="width:21em; font-size: 90%; text-align: left;" ! colspan="2" style="text-align: center; font-size: 130%;" | Lucia Bot [[File:Crystal Clear action run.svg|24px|This user is a bot.]] |- | colspan="2" style="text-align: center; font size: 95%;" | ([[{{TALKSPACE}}:Lucia Bot|talk]] · [[Special:Contributions/Lucia Bot|contribs]]) <tr><th>Operator:</th><td>Beria</td></tr> <tr><th>[[Wikipedia:Bots/Requests for approval|Approved]]?</th><td>[[:pt:Wikipedia:Bots/Requests for approval/{{PAGENAME}}|in pt.wiki yes]], but not here</td></tr> <tr><th>[[Wikipedia:User_access_levels#Bots|Flagged]]?</th><td>no</td></tr> <tr><th>[[Wikipedia:Bot requests|Task/s]]:</th><td> (in [[:pt:|pt.wikipedia]]) general bot</td></tr> <tr><th>Edit rate:</th><td>10 per minut</td></tr> <tr><th>Edit period/s:</th><td>Periodically</td></tr> <tr><th>Automatic or manual?</th><td>automatic</td></tr> <tr><th>[[:w:Programming language|Programming language]]/s:</th><td>[[Python]]</td></tr> <tr><th>Other information:</th><td>See too [[User:Ripchip Bot|Ripchip Bot]]</td></tr> |} {| border="0" align="left" style="margin-left:1em; margin-bottom:1em;" width="370px" ! colspan="2" | {| align="center" | {| cellpadding="10" style="border-collapse:collapse; background-color:transparent; border-style:none;" | width="10" valign=top | [[Image:cquote1.png|20px]] | ''Lúcia, esta continuou sempre com os mesmos cabelos dourados e a mesma alegria, e todos os príncipes desejavam que ela fosse a sua rainha. E foi chamada de Lúcia, a Destemida.'' | valign=bottom |[[Image:cquote2.png|20px]] |} |<br clear=all><div align="right"><small>'''[[w:Lucy Pevensie|A Rainha Lúcia]]'''</small></div> |} |} <!-- BABEL --> {| width="270px" style="background: transparent" align="right" | valign="top"| <div style="text-align:center; background:transparent; border:solid transparent 1px"> <div style="background:#F5F5F5">'''Babel'''</div> <div align="center"> {| | <div style="float: left; border:solid #99B3FF 1px"> {| cellspacing="0" style="width: 250px; background: #E0E8FF" | style="width: 50px; height: 50px; background: #99B3FF; text-align: center; font-size: 14pt" | '''PY''' | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; color: black" | Este utilizador tem como língua '''materna''' o '''Pythonês'''. |}</div> |- | <div style="float: left; border:solid #6ef7a7 1px"> {| cellspacing="0" style="width: 250px; background: #c5fcdc" | style="width: 50px; height: 50px; background: #6ef7a7; text-align: center; font-size: 12pt" | '''[[Image:Gnome-globe.svg|50px]]''' | style="font-size: 8pt; padding: 4pt; line-height: 1.25em; color: black" | Este utilizador é '''poliglota''', e/ou conhece '''todos''' os idiomas existentes. |}</div> |} |} <!-- BABEL --> <!-- Userbox--> {| width="270px" style="background: transparent" align="right" | valign="top"| <div style="text-align:center; background:transparent; border:solid transparent 1px"> <div style="background:#F5F5F5">'''Userbox'''</div> <div align="center"> {| | <div style="float:right;border:solid blue 1px;margin:1px;"> <table cellspacing="0" style="width:236px; background:snow"> <tr> <td style="width:45px;height:45px; background: snow; text-align:center;font-size:13pt;"> [[Image:Narnia aslan.jpg|35px|Aslam]] </td> <td style="font-size:8pt;padding:4pt;line-height:1.25em; color:black;" align=left> This '''[[Special:ListUsers/bot|Narnian]]''' is a daugther of '''[[User:Beria|Béria Lima]]''' and is at your service here and in [[:w:C. S. Lewis#The Chronicles of Narnia|Narnia]].</font></td> </tr></table></div> |} |} <br clear="all"> {| style="border: 1px solid #aaa; background-color: snow; width: 80%; margin: 0 auto 1em auto; padding: .2em;" class="plainlinks" |align="center"|[[Image:Crystal Clear action run.svg|50px]] |align="left" width="100%"|'''This user account is a [[Wikiquote:Bots|bot]] operated by [[User:Beria|Béria Lima]].''' It is not a [[w:Wikipedia:Sock puppetry|sock puppet]], but rather an automated or semi-automated account for making repetitive edits that would be extremely tedious to do manually. <br> <small>''Administrators: if this bot is malfunctioning or causing harm, please [{{fullurl:Special:Blockip|wpBlockAddress={{PAGENAMEE}}&wpBlockExpiry=indefinite&wpAnonOnly=0&wpEnableAutoblock=0&wpCreateAccount=0&wpBlockReason=Bot%20malfunctioning:%20}} block it].''</small> |}</div> [[Category:Bot accounts]] aie25698ol988s2sc6z2z6odglr5i2f Gebruikerbespreking:Lucia Bot 3 2316 4282 2011-08-13T16:46:14Z Lucia Bot 790 Creating global talk page 4282 wikitext text/x-wiki <div align="center"> {| | <div style="float:right;border:solid blue 1px;margin:1px;"> <table cellspacing="0" style="width:736px; background:snow"> <tr> <td style="width:75px;height:75px; background: snow; text-align:center;font-size:13pt;"> [[File:Narnia_aslan.jpg|80px|link=User talk:Beria]] </td> <td style="font-size:8pt;padding:4pt;line-height:1.25em; color:black;" align=left><center>'''To sysops''': If Lucia is doing something wrong, please, [[Special:Blockip/Lucia Bot|block her]] and [[User talk:Beria|tell me]].</center><br /> <center>''For any other subjects, please contact [[User talk:Beria|the operator of the bot]].''</center></font></td> </tr></table></div> |}</div> 8ozzq2y6uvuwblmqlzaykk6sofpw81y Gebruiker:Royce 2 2317 4284 2011-08-19T22:16:17Z Royce 794 Nuwe bladsy geskep met 'Hello! Welcome to my basic user page. ~~~~ * My unified username is [http://toolserver.org/~vvv/sulutil.php?&user=Royce Royce] ([http://toolserver.org/~vvv/sulutil.php?ri...' 4284 wikitext text/x-wiki Hello! Welcome to my basic user page. [[Gebruiker:Royce|Royce]] 22:16, 19 Augustus 2011 (UTC) * My unified username is [http://toolserver.org/~vvv/sulutil.php?&user=Royce Royce] ([http://toolserver.org/~vvv/sulutil.php?rights=1&user=Royce rights]). * For more about me, see [http://en.wikipedia.org/wiki/User:Royce my English Wikipedia page]. 2op2fvrwli73chtddeqlx5nv9k84ngl Gebruiker:Waihorace 2 2318 4954 4285 2015-01-25T18:46:22Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Waihorace]]) 4954 wikitext text/x-wiki {{#babel:en-3|yue-N|zh-hant-N}} Hi! I am '''Waihorace''' and I am a member of the [[:m:SWMT|Small Wiki Monitoring Team]]. If you would like to contact me, it is recommended that you leave your message on my talk page on ''[[m:User talk:Waihorace|Meta-Wiki]]''. 2i1tajk7qqojtvn0r2vbyf7mzj9xgco Gebruiker:Vibhijain 2 2322 6506 4293 2020-03-03T05:50:39Z CommonsDelinker 24 Removing [[:c:File:Vibhijain.jpg|Vibhijain.jpg]], it has been deleted from Commons by [[:c:User:Taivo|Taivo]] because: author's request. 6506 wikitext text/x-wiki Hi! I am Vaibhav from India! I am an administrator on Hindi Wiktionary and Pali Wikipedia and former admin at Sanskrit Wikipedia. I am a rollbacker and file mover on English. I am also a translator on Beta-Wiki and I am working on the test project of Sanskrit Wikiquote at incubator.<br /> [[m:w:sa:User:Vibhijain|HERE'S MY SANSKRIT WIKIPEDIA PAGE!!!]]<br /> [[m:w:en:User:Vibhijain|HERE'S MY ENGLISH WIKIPEDIA PAGE!!!]] [[File:RCPatroller Badge.png|150px|thumb|This user is a Recent Changes Patroller.]] 4l7wz0ze5mrshf76swm3vzk559l6rva Gebruiker:Xic667 2 2323 4294 2011-09-11T18:08:05Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4294 wikitext text/x-wiki [[m:fr:Utilisateur:Xic667]] 5a9qnutktwxy977i7k8rkds1l0ymt05 Gebruiker:Toto Azéro 2 2324 4295 2011-09-11T18:37:05Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4295 wikitext text/x-wiki [[Image:Redirectltr.png|#REDIRECT]]<span class="redirectText" id="softredirect">[[:meta:user:Toto Azéro]]</span> fiq0h8khtrt3woby2idcyjalpmmjod3 Gebruiker:KuduIO/common.js 2 2325 4296 2011-09-11T20:11:57Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4296 javascript text/javascript mw.loader.load('http://meta.wikimedia.org/w/index.php?title=User:KuduIO/global.js&action=raw&ctype=text/javascript'); 8i4cm8eeykhurss7kuhrpirf4cuh5z9 Boekrak:Letterkunde 0 2327 4298 2011-09-17T16:09:32Z Jan Slimkop 326 Nuwe bladsy geskep met ''''Literatuur''' oftewel '''letterkunde''' dui op geskrewe tekste wat aan 'n bepaalde literêre of estetiese standaard voldoen. Boeke hieroor handel oor enigiets wat met let...' 4298 wikitext text/x-wiki '''Literatuur''' oftewel '''letterkunde''' dui op geskrewe tekste wat aan 'n bepaalde literêre of estetiese standaard voldoen. Boeke hieroor handel oor enigiets wat met letterkunde of die taal te doen het. Lys van boeke: * [[Lys van bybelse idiome]] t7xyevxpxisynjhzdkpof77gh5yr4ko Lys van bybelse idiome 0 2328 6753 6738 2020-07-08T02:52:54Z Minorax 2092 Wysigings deur [[Special:Contributions/176.227.4.8|176.227.4.8]] teruggerol na laaste weergawe deur [[User:Hamish|Hamish]] 4316 wikitext text/x-wiki ''Met 'n ysterstaf regeer''. '''Betekenis''': Geen oposisie duld nie. (Op. 2:27) 6mtlhra63wlhz02qgrxs7m9wpyvb2gg Gebruiker:Alan ffm 2 2329 4305 2011-09-17T20:11:09Z Alan ffm 615 Nuwe bladsy geskep met '{{babel|pl|de-4|en-2|ru-2}}' 4305 wikitext text/x-wiki {{babel|pl|de-4|en-2|ru-2}} 8bek0g1em58n2sd90723204kn28wofm Boekrak:Programmering 0 2330 4942 4311 2014-12-15T17:34:55Z Eurodyne 1415 changing to redirect 4942 wikitext text/x-wiki #REDIRECT [[HTML]] nlqbt92k4slz3z9aregw49317fens27 Boekrak:Aardrykskunde 0 2331 6683 6682 2020-06-12T12:26:40Z Samuele2002 1787 Wysigings deur [[Special:Contributions/Лгаоэ|Лгаоэ]] teruggerol na laaste weergawe deur [[User:~riley|~riley]] 4312 wikitext text/x-wiki [[Hoe om 'n atlas te gebruik]] 0aw6ibvtmac5dlaj973gnx3ik2qne3e Boekrak:Spyseniering 0 2332 4941 4315 2014-12-15T17:33:39Z Eurodyne 1415 redirecting 4941 wikitext text/x-wiki #REDIRECT [[Kookboek]] 7up8ozbbmhf8ogjuuimurdhrn5bx746 Gebruiker:Hoo User Page Bot 2 2334 4326 2011-10-12T23:08:28Z Hoo User Page Bot 827 Creating global bot page 4326 wikitext text/x-wiki {| class="infobox" style="width: 21em; font-size: 90%; text-align: left; float: right; background-color: rgb(249, 249, 249); border: 1px solid rgb(170, 170, 170);" ! colspan="2" style="text-align: center; font-size: 130%;" | {{BASEPAGENAME}} [[File:Crystal Clear action run.svg|24px|This user is a bot.]] |- | colspan="2" style="text-align: center; font size: 95%;" | ([[{{TALKSPACE}}:{{BASEPAGENAME}}|talk]] · [[Special:Contributions/{{BASEPAGENAME}}|contribs]]) |- | Operator: || [[m:User:Hoo man|Hoo man]] |- | [[Wikipedia:Bots/Requests for approval|Approved]]? || No |- | [[Wikipedia:User_access_levels#Bots|Flagged]]? || No |- | [[Wikipedia:Bot requests|Task/s]]: || [[m:User:Hoo_man/Synchbot|Syncing user and user talk pages across all wikis]] |- | Edit rate: || Max. a few edits per month |- | Edit period/s: || Periodically |- | Automatic or manual? || half-automatic |- | [[w:en:Programming language|Programming language]]/s: || [[w:en:Python|Python]] |- |} This bot syncs user and user talk pages across all wikis, request can be made [[m:User:Hoo_man/Synchbot|here]]. Feel free to complain if it does anything it shouldn't. Every request gets performed and reviewed by [[m:user:Hoo man|Hoo man]]. czscg30nvej6k7apod8zsjv1761ygs5 Gebruiker:Vugar 1981 2 2337 4329 2011-10-13T04:39:49Z Vugar 1981 828 Nuwe bladsy geskep met ''''Vugar 1981''' is a user on Wikimedia wikis such as Wikipedia, Wikisource, Wikinews and more. I am a native Azerbaijani speaker and I also speak Turkish. My home wiki i...' 4329 wikitext text/x-wiki '''Vugar 1981''' is a user on Wikimedia wikis such as Wikipedia, Wikisource, Wikinews and more. I am a native Azerbaijani speaker and I also speak Turkish. My home wiki is the [[m:w:az:|Azerbaijani Wikipedia]]. If you have any problems or want to discuss anything with me, feel free to go to my talk page on [[m:User talk:Vugar 1981|Metawiki]] or on the [[m:w:az:User talk:Vugar 1981|Azerbaijani Wikipedia]]. dbzmlnc711lltji04b5kuk94lqy9nf6 Gebruiker:Bennylin 2 2338 4330 2011-10-18T21:17:14Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4330 wikitext text/x-wiki {{#babel:id|en-4}} Hi, I'm Benny and I'm probably doing some edits on this wiki as part of the [[m:countervandalism network|countervandalism network]]. You can view my profile and contact me through one of these wikis that I often visit. <div class="plainlinks"> * [ [[m:User:Bennylin|User]] | [[m:User talk:Bennylin|Talk]] | [[m:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:m:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [[m:Special:Log/Bennylin|Logs]] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=metawiki_p Counts] | [{{fullurl:m:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[m:|Meta]] ] * [ [[m:w:id:User:Bennylin|User]] | [[m:w:id:User talk:Bennylin|Talk]] | [[m:w:id:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:m:w:id:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [{{fullurl:m:w:id:Special:Log|user=Bennylin}} Logs] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=idwiki_p Counts] | [{{fullurl:m:w:id:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[m:w:id:|id Wikipedia]] ] [[File:Gnome-home.svg|x20px]] * [ [[m:wikt:id:User:Bennylin|User]] | [[m:wikt:id:User talk:Bennylin|Talk]] | [[m:wikt:id:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:m:wikt:id:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [{{fullurl:m:wikt:id:Special:Log|user=Bennylin}} Logs] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=idwiktionary_p Counts] | [{{fullurl:m:wikt:id:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[m:wikt:id:|id Wiktionary]] ] * [ [[m:s:id:User:Bennylin|User]] | [[m:s:id:User talk:Bennylin|Talk]] | [[m:s:id:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:m:s:id:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [{{fullurl:m:s:id:Special:Log|user=Bennylin}} Logs] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=idwikisource_p Counts] | [{{fullurl:m:s:id:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[m:s:id:|id Wikisource]] ] * [ [[commons:User:Bennylin|User]] | [[commons:User talk:Bennylin|Talk]] | [[commons:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:commons:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [{{fullurl:commons:Special:Log|user=Bennylin}} Logs] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=commonswiki_p Counts] | [{{fullurl:commons:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[commons:|Commons]] ] * [ [[m:w:en:User:Bennylin|User]] | [[m:w:en:User talk:Bennylin|Talk]] | [[m:w:en:Special:Contributions/Bennylin|Contribs]] | [{{fullurl:m:w:Special:ActiveUsers|limit=1&username=Bennylin}} Activity] | [{{fullurl:m:w:Special:Log|user=Bennylin}} Logs] | [http://toolserver.org/~vvv/yaec.php?user=Bennylin&wiki=enwiki_p Counts] | [{{fullurl:m:w:Special:ListUsers|limit=1&username=Bennylin}} Rights] ] at [ [[m:w:|en Wikipedia]] ] * [[sulutil:Bennylin|Me on all Wikimedia projects]] * [http://toolserver.org/~krinkle/MoreContributions/index.php?username=Bennylin&wikidb=&allwikis=on&submit=Go Recent edits]<!-- neat! --> * [http://toolserver.org/~pathoschild/crossactivity/?user=Bennylin Cross-wiki activities] * [http://toolserver.org/~luxo/contributions/contributions.php?user=Bennylin&lang=en Cross-wiki contributions] * [http://toolserver.org/~erwin85/xcontribs.php?user=Bennylin Cross-wikiness] * This wiki: [[Special:Statistics]], [[Special:NewPages]], [[Special:RecentChanges]] </div> cftwp8yoicb19sxew5c6dzravjkf5xj Gebruiker:Azariv-WMF 2 2342 5073 4338 2015-04-16T19:19:50Z Jalexander-WMF 586 Jalexander-WMF het bladsy [[Gebruiker:Azariv]] na [[Gebruiker:Azariv-WMF]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Azariv|Azariv]]" to "[[Special:CentralAuth/Azariv-WMF|Azariv-WMF]]" 5073 wikitext text/x-wiki My name is Alex Zariv, I am a [[wmf:Job_openings/Fundraiser_Production_Coordinator|Production Coordinator]] with the [[wmf:Main Page|Wikimedia Foundation]] and am working on this year's [[m:Fundraising 2011|fundraiser]]. This account is used for edits while officially representing the foundation. In my volunteer capacity I can usually be found on [[m:|meta]] where I am an elected administrator. You can reach me either through [[Special:EmailUser/Azariv|e-mail]] or on my Meta-Wiki [[m:User talk:Azariv|talk page]]. On wiki (on all wmf projects) I am [[m:User:Az1568|Az1568]] in my volunteer role and [[m:User:Azariv|Azariv]] in my WMF role. 2krx4dg1poqcfutqrxz7yheu0znw394 Gebruiker:Gzen92 2 2344 4342 2011-11-09T11:56:25Z Gzen92 841 Nuwe bladsy geskep met '[http://fr.wikibooks.org/wiki/Utilisateur:Gzen92 Gzen92 (fr.wikibooks.org)]' 4342 wikitext text/x-wiki [http://fr.wikibooks.org/wiki/Utilisateur:Gzen92 Gzen92 (fr.wikibooks.org)] rmby6huk7tlqvn3mjgvtn980p30o3qg Gebruikerbespreking:Gzen92 3 2345 4343 2011-11-09T11:56:54Z Gzen92 841 Nuwe bladsy geskep met '[http://fr.wikibooks.org/wiki/Discussion_utilisateur:Gzen92 Gzen92 (fr.wikibooks.org)]' 4343 wikitext text/x-wiki [http://fr.wikibooks.org/wiki/Discussion_utilisateur:Gzen92 Gzen92 (fr.wikibooks.org)] sow6fq0ca0anfymuttfw4wxoo86qdkt Gebruikerbespreking:Caypartis 3 2346 4345 2011-11-11T19:38:20Z Caypartis 825 global talk page 4345 wikitext text/x-wiki {| width="100%" cellspacing="0" cellpadding="0" valign="top" border="0" style="font-size:14px; border:1px solid #C2dfff; -moz-box-shadow: 0 1px 3px rgba(0, 0, 0, 0.35); -webkit-box-shadow: 0 1px 3px rgba(0, 0, 0, 0.35); box-shadow: 0 1px 3px rgba(0, 0, 0, 0.35); background: #E7FFFF; background: -moz-linear-gradient(top, #A7D7F9 0%, #7db9e8 100%); background: -webkit-gradient(linear, left top, left bottom, color-stop(0%,#E7FFFF), color-stop(100%,#7db9e8)); background: -webkit-linear-gradient(top, #E7FFFF 0%,#7db9e8 100%); background: -o-linear-gradient(top, #E7FFFF 0%,#7db9e8 100%); background: -ms-linear-gradient(top, #E7FFFF 0%,#7db9e8 100%); background: linear-gradient(top, #E7FFFF 0%,#7db9e8 100%); -moz-border-radius: 7px; -webkit-border-radius: 7px; border-radius: 7px; font-family:Calibri, Verdana, sans-serif; padding: 10px;" |class="onglet" style="text-align: center; padding: 0.3em; 0; font-size: 100%; background-color:transparent; -moz-border-radius: 7px 0 0 7px; -webkit-border-radius: 7px 0 0 7px; border-radius: 7px 0 0 7px; font-size: 150%" width="14.666666666667%" |Hello, Please don't leave your message here, contact me at [[wikipedia:User_talk:Caypartis|enwiki]] or send me an [[wikipedia:Special:EmailUser/Caypartis|e-mail]] |} __NOINDEX__ __NONEWSECTIONLINK__ 2zxr0w7yhdaxbq45w1bakg5lyv4cgon Gebruiker:Sönke Rahn 2 2347 4346 2011-11-12T03:38:50Z Sönke Rahn 848 Nuwe bladsy geskep met '*[[:de:Benutzer:Soenke Rahn|Alter Ego]]' 4346 wikitext text/x-wiki *[[:de:Benutzer:Soenke Rahn|Alter Ego]] saoz56tjdxgb3e7via7ui9nnajxqibc Gebruikerbespreking:Caypartisbot 3 2348 4351 2011-11-13T17:22:11Z Caypartis 825 Stuur aan na [[Gebruikerbespreking:Caypartis]] 4351 wikitext text/x-wiki #Redirect [[User talk:Caypartis]] 5w6gdei0m3ocj06iptez9hqo4hp6oar Gebruiker:Caypartisbot 2 2349 4353 4352 2011-11-13T17:25:58Z Caypartis 825 4353 wikitext text/x-wiki {{bot|Caypartis|site=w:en}} __NOINDEX__ nmlgzij15wkzczvd7adio9s858oefh6 Gebruikerbespreking:He7d3r 3 2350 4888 4355 2014-09-15T18:08:34Z Vogone 1002 Vogone het bladsy [[Gebruikerbespreking:Helder.wiki]] na [[Gebruikerbespreking:He7d3r]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Helder.wiki|Helder.wiki]]" to "[[Special:CentralAuth/He7d3r|He7d3r]]" 4888 wikitext text/x-wiki __NOINDEX__'''Contact information''': [{{fullurl:m:b:pt:User talk:{{BASEPAGENAME}}|uselang=af}} @pt.wikibooks] 9auoqae9gh8slxptdbg16vvk31gpi94 Gebruiker:Man77/common.css 2 2353 4358 2011-11-20T04:15:34Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4358 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:Man77/global.css&action=raw&ctype=text/css"; k4a5otem87q3bqo2scekjudlsbs69jz Gebruiker:Der Buckesfelder/common.js 2 2354 4360 2011-11-21T03:59:41Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4360 javascript text/javascript mw.loader.load("//de.wikipedia.org/w/index.php?title=Benutzer:Der_Buckesfelder/global.js&action=raw&ctype=text/javascript"); a7p0swpbmn4nyeor8lc0eb59iyyon31 Gebruiker:AleXXw 2 2355 4361 2011-11-21T23:44:41Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4361 wikitext text/x-wiki {{#babel:de-at|de|en-2|fr-1}} [[:m:w:de:Benutzer:AleXXw|Me@de-WP]] p3gp65sknf5oqvup1faw385y5h0x7xg Gebruiker:Der Buckesfelder 2 2356 4372 4362 2011-11-23T23:55:57Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4372 wikitext text/x-wiki [[File:Redirectltr.png]][[m:w:de:User talk:Der Buckesfelder|w:de:{{ns:2}}:Der Buckesfelder]] 0f48i4mljazkhfa857nbkeoxcb3wrak Gebruikerbespreking:Der Buckesfelder 3 2357 4373 4363 2011-11-24T00:24:58Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4373 wikitext text/x-wiki [[File:Redirectltr.png]][[m:w:de:User talk:Der Buckesfelder|w:de:{{ns:3}}:Der Buckesfelder]] 9n2v72zuyl2v4hnhc54u4icc1goeoap Gebruiker:PeterSymonds/common.js 2 2359 4365 2011-11-22T18:08:25Z Wikitanvir 549 Creating global CSS 4365 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:PeterSymonds/global.js&action=raw&ctype=text/javascript'); mmg2um66229wd3g61019pivj01rch4b Sjabloon:Bot 10 2360 4370 4369 2011-11-22T19:43:01Z Wikitanvir 549 Fix 4370 wikitext text/x-wiki {| align="center" class="plainlinks" style="padding: 8px; border: 2px solid #000; width: 80%; text-align: justify;" |- valign="center" | [[File:Crystal Clear action run.svg|90px|left|link=]] || '''This user account is a [[m:en:Wikipedia:Bots|bot]], operated by [[User:{{{1}}}|{{{1}}}]] ([[User talk:{{{1}}}|talk]]).'''<br />It is not a [[m:en:Wikipedia:Sock puppetry|sock-puppet]], but rather an automated or semi-automated account for making repetitive edits that would be extremely tedious to do manually.<br />''Administrators: if this bot is malfunctioning or causing harm, please [{{fullurl:Special:Blockip|wpBlockAddress={{PAGENAMEE}}&wpBlockExpiry=indefinite&wpAnonOnly=0&wpEnableAutoblock=0&wpCreateAccount=0&wpBlockReason=Bot%20malfunctioning:%20}} block it].'' |}<noinclude> == Documentation == * Replace "Example" with your bot's username. {| class="wikitable" width="100%" |- ! width="200px" | Code ! Result |- | <code><nowiki>{{Bot|Example}}</nowiki></code> | {{Bot|Example}} |}</noinclude> 66x7xz2ij3ykg9hbgomgcy4y3g2qkiz Gebruiker:Micki/common.css 2 2361 4371 2011-11-23T06:16:21Z Wikitanvir 549 Creating global CSS as [[m:User:Hoo man/Synchbot|requested]] 4371 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:Micki/global.css&action=raw&ctype=text/css"; cpr3xntm9rzjg23ilb2hue0i4y8kz3h Gebruiker:Buckesfelder 2 2362 4375 4374 2011-11-24T01:01:19Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4375 wikitext text/x-wiki #REDIRECT[[User:Der Buckesfelder]] 23k07le0nklkphoyfxykgk1277lnrpm Gebruikerbespreking:Buckesfelder 3 2363 4376 2011-11-24T01:22:17Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4376 wikitext text/x-wiki #REDIRECT[[User talk:Der Buckesfelder]] 5mru9et2v2qwhwni0dkjmpjjek5ei3u Gebruiker:Buckesfelder/common.js 2 2364 4377 2011-11-24T01:42:15Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4377 javascript text/javascript mw.loader.load("//de.wikipedia.org/w/index.php?title=Benutzer:Der_Buckesfelder/global.js&action=raw&ctype=text/javascript"); a7p0swpbmn4nyeor8lc0eb59iyyon31 Gebruiker:Addihockey10 (automated) 2 2366 4379 2011-11-25T22:54:10Z Addihockey10 (automated) 855 Creating global bot page, per user request 4379 wikitext text/x-wiki {{bot|Addihockey10}} 98xfvu14qwd905kpf1brmr0zqkrzlvr Gebruiker:Daniyar 2 2367 4578 4381 2012-11-08T03:43:02Z Dualitas 992 Robot: dubbele aanstuur na [[kk:Қатысушы:Daniyar]] reggemaak 4578 wikitext text/x-wiki #AANSTUUR [[:kk:Қатысушы:Daniyar]] sva9vfrcfx9r7oqsj8io4hzakkkz9ln Gebruiker:Djsasso 2 2368 4382 2011-12-04T16:12:17Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4382 wikitext text/x-wiki __NOTOC__ {| class="toccolours plainlinks" style="width:95%; margin:0 1em 0 1em; text-align:center;" |- style="color:#FFF;" ! style="background:#0B0B3B;" | Host wiki ! style="background:#0B0B3B;" | Account ! style="background:#0B0B3B;" | User page ! style="background:#0B0B3B;" | User talk ! style="background:#0B0B3B;" | Contributions ! style="background:#0B0B3B;" | Logs ! style="background:#0B0B3B;" | Edits |- style="background:#F0F0F0;" | style="text-align:left;" | [[File:Wikipedia-logo.png|20px]] [[m:en:Main Page|Wikipedia (en)]] | Admin | [[m:en:User:Djsasso|User:DJSasso]] | [[m:en:User talk:Djsasso|User talk:DJSasso]] | [[m:en:Special:Contributions/Djsasso|Contribs]] | [[m:en:Special:Log/Djsasso|Logs]] | [http://toolserver.org/~interiot/cgi-bin/count_edits?user=Djsasso&dbname=enwiki_p Count] |- style="background:#DCDCDC;" | style="text-align:left;" | [[File:Wikipedia-logo.png|20px]] [[m:simple:Main Page|Wikipedia (simple)]] | Bureaucrat / CheckUser / Oversighter | [[m:simple:User:Djsasso|User:DJSasso]] | [[m:simple:User talk:Djsasso|User talk:DJSasso]] | [[m:simple:Special:Contributions/Djsasso|Contribs]] | [[m:simple:Special:Log/Djsasso|Logs]] | [http://toolserver.org/~interiot/cgi-bin/count_edits?user=Djsasso&dbname=enwiki_p Count] |} mskhgbka83jasomr6987xe9svv3ducf Gebruikerbespreking:Billinghurst 3 2372 4388 2011-12-19T09:15:15Z Billinghurst 870 Nuwe bladsy geskep met '{{softredirect|m:user talk:billinghurst}}' 4388 wikitext text/x-wiki {{softredirect|m:user talk:billinghurst}} 797xp8s834df37m164ayal1cflhmawy Gebruiker:Anashir 2 2373 4390 2012-01-04T12:36:27Z Anashir 822 Nuwe bladsy geskep met '{{softredirect|:id:User:Anashir}}' 4390 wikitext text/x-wiki {{softredirect|:id:User:Anashir}} fjjcp9t8lwsd0mgbk9fo4ol2pyb9r32 Gebruiker:AddihockeyBot 2 2374 4392 4391 2012-01-07T19:17:09Z Hoo User Page Bot 827 Creating global user page, per request 4392 wikitext text/x-wiki This interwiki bot is operated by [[m:User:Addihockey10]] {{bot|Addihockey10}} 024q1j4xmvpg75yujfppprftgwapqk7 Gebruiker:Sue Gardner 2 2375 4393 2012-01-12T00:14:14Z Jalexander-WMF 586 creating global user pages for WMF Staff member upon request ([[m:User:Jalexander|Questions?]]) 4393 wikitext text/x-wiki [[File:Wikimedia Foundation Sue Gardner Red BG Sept 2010.jpg|thumb|Sue Gardner the Executive Director of the Wikimedia Foundation]] I'm the Executive Director of the Wikimedia Foundation. I've been working at the Foundation since June 2007 - first in St. Petersburg, Florida, and now in San Francisco, California. Before that, I ran CBC.CA, the website of Canada's national public broadcaster. And before that, I was a radio and television journalist for 10 years. I can read and understand simple text in French and Spanish, at a very basic level, slowly and imperfectly. But I am only fluent in English. I frequently use Google Translate to understand discussions on the wikis in other languages, and I sometimes leave people messages in their own languages that I wrote using Google Translate or with the help of a colleague. I very much appreciate when people are able to correspond with me in English :-) You can reach me these ways: * The best & fastest way is by e-mail at sue[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org * In the office at (415) 839-6885 * Skype is susanpgardner * My username on the projects is ''Sue Gardner'' * Mailing address is Wikimedia Foundation, 149 New Montgomery Street, Third Floor, San Francisco CA 94105 * http://www.linkedin.com/in/suegardner ''The information on this page is meant to give answers to the questions I'm most often asked. If you have a question that's not answered here, please ask it on my talk page, or e-mail me at sue[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. Thanks. [[User:Sue Gardner|Sue Gardner]] 04:13, 18 May 2010 (UTC)'' ;Do you edit the Wikimedia projects, and if so, do you have any special status? How are other editors supposed to treat your edits? :I occasionally edit articles on the English Wikipedia. My Wikipedia editing is purely opportunistic and reactive: while using Wikipedia, if I see a mistake or problem, I sometimes try to fix it. When I edit, I am in no way acting as an official representative of the Wikimedia Foundation, and my edits should be treated like anyone else's. ;I have a question or a comment about Wikipedia. Where can I send it? :Please send it to info-en[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. Mail sent to that address is handled by a global network of volunteers - the same people who write Wikipedia - and they will be happy to reply to you. Please note that if you have a concern about the article about you, your organization, or someone you know, it might be worth your while to [[w:en:Wikipedia:FAQ/Article subjects|read the Article Subjects FAQ]] first. And thank you for reading Wikipedia. ;I am angry about an editorial dispute I'm having on one of the Wikimedia projects. Can you help me? :No, I'm sorry, I can't. The Wikimedia editorial community is responsible for resolving editorial disputes, and I don't interfere with those processes. ;I am angry about the way I or my company is being characterized on one of the Wikimedia projects. What can I do? :If you have questions or concerns about a Wikipedia article covering you or your organization, [[w:en:Wikipedia:FAQ/Article subjects|please see the Article Subjects FAQ]]. ;I would like to make a donation, or, I have a question about my donation. :If you are a Wikimedia donor or prospective donor, or if you have questions about our fundraising operations, first: thank you! You can send donation-related questions, comments and feedback to our fundraising team, at donate[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. Or, just [[wmf:Support Wikipedia/en|go here to donate]]. ;I'm a journalist, and would like to speak with you for a story I'm working on. Who do I contact? :You can e-mail me directly at sue[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org, or e-mail Wikimedia's spokesperson and Head of Communications, Jay Walsh, at jwalsh[[Image:Nospam at.svg|13px| -at- ]]wikimedia.org. Sometimes it is faster to go to Jay first, rather than trying to reach me directly. ;Where can I send a speaking invitation? :Please send speaking invitations to The Lavin Agency, at info[[Image:Nospam at.svg|13px| -at- |link=]]thelavinagency.com or +1 800 265 4870. I like to speak, but I only have time to do it a half-dozen or so times a year, so unfortunately I need to turn down most requests. Your invitation is likeliest to be accepted if your event is large and/or education-focused; if your audience is primarily people that Wikimedia wants to reach as partners or prospective new editors (e.g., teachers/students, NGO/NPO staff, women); and if your event is taking place in a region that's a high priority for us: primarily India, Brazil, the Arabic-speaking Middle East / North Africa. :Please note: if you're a Wikimedian, you don't need to go through Lavin. In that case, it's probably fastest for you to just write me and [[User:James Owen|James]]. ;Do you provide reference-type letters for Wikimedians? :Yes, definitely. If you want a reference letter, please just ask whoever you know best on the staff: we are all happy to provide reference letters. If you want one from me, please mail me or James. If you don't know anybody on the staff personally, please e-mail Philippe Beaudette at pbeaudette[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. Please note I don't do LinkedIn recommendations. ;How can I find out about jobs at the Wikimedia Foundation? :[[wmf:Job openings|All Wikimedia Foundation jobs are posted here]]. ;I would like permission to reuse material from Wikipedia or one of the other Wikimeda projects. :First, please be aware that you can reuse Wikipedia article text anywhere you like, without asking permission, as long as you adhere to the conditions of the license. Wikipedia is freely licensed under the Creative Commons license CC-BY-SA: [http://creativecommons.org/licenses/by-sa/3.0 go here to read a simple explanation of the CC-BY-SA license], or [http://creativecommons.org/licenses/by-sa/3.0/legalcode go here to read the full legal text]. If you want to use the Wikipedia trademark, please read [[wmf:Trademark Policy|our trademark policy]]. ;I would like to send you a business proposal. :First, please be aware that I get lots of proposals: I cannot and do not respond to them all. If your proposal doesn't seem rooted in a pretty good understanding of who we are and what we do, I will almost certainly ignore it. (We are interested in partnerships that would accelerate the growth of Wikipedia's readership particularly outside Europe and North America, that help us recruit new editors, and/or that improve article quality.) Regardless, there will often be a delay of several weeks before you get a response: this is completely normal. Most proposals I receive, I on-pass to the relevant staff - business proposals go to Kul Takanao Wadhwa at kul[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org, and proposals offering technical services or products go to CT Woo at ctwoo[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. Please don't send us proposals for staffing solutions: we have good help for that, and we're not looking for more. ;Can I get an official photo? :[[wmf:File:Sue Gardner May 2008 B.JPG|Here's my official photo]]. ;Can I get your official biography? :Yes, it's below. Please note this version may not be up-to-date. If you need a bio that's guaranteed to be current, please contact my assistant James Owen, at jowen[[Image:Nospam at.svg|13px| -at- |link=]]wikimedia.org. {| align="center" style="border-collapse:collapse; border-style:none; background-color:transparent;" class="cquote" | width="20" valign="top" style="color:#B2B7F2;font-size:35px;font-family:'Times New Roman',serif;font-weight:bold;text-align:left;padding:10px 10px;" | “ | valign="top" style="padding:4px 10px;" | Sue Gardner is Executive Director of the Wikimedia Foundation, the non-profit organization behind Wikipedia - the world's largest and most popular encyclopedia, which is free to use and free of advertising. Wikipedia contains more than 15 million volunteer-authored articles in 250+ languages, and is visited by more than 365 million people every month, making it the number five most-popular website in the world. Since joining the Wikimedia Foundation in summer of 2007, Gardner has more than tripled revenues, supported an 85% increase in global readership, and instituted projects and activities designed to grow readership and attract new editors. Gardner, a seasoned journalist, was formerly head of CBC.CA, the website for the Canadian Broadcasting Corporation, one of Canada's most prominent and best-loved cultural institutions. Under her leadership, CBC.CA won many international awards for excellence, and grew to become Canada's most popular news site. Gardner started her career in 1990 as a producer with CBC's “As It Happens,” an internationally-recognized groundbreaking news and current events radio program. She has since worked in radio, television, newspapers, magazines and online. | width="20" valign="bottom" style="color:#B2B7F2;font-size:36px;font-family:'Times New Roman',serif;font-weight:bold;text-align:right;padding:10px 10px;" | ” |- |} 0ebyob4e7ofrgtm99ma6lwob11p9hbw Gebruikerbespreking:Addihockey10 (automated) 3 2382 4407 2012-02-01T19:52:35Z Hoo User Page Bot 827 Creating global talk page, per user request on IRC 4407 wikitext text/x-wiki {{#ifexist: Template:Soft redirect | {{Soft redirect|meta:User talk:Addihockey10}} | {{#ifexist: Template:Softredirect | {{Softredirect|meta:User talk:Addihockey10}} | [[meta:User talk:Addihockey10]] }}}} ks9odd5s4vztq8w748arewrnrh2uw4l Gebruiker:Nihonjoe 2 2383 5639 4411 2019-06-13T00:27:59Z Nihonjoe 539 thanks 5639 wikitext text/x-wiki Greetings! Please contact me at my [[m:w:en:User talk:Nihonjoe|main user talk page]] on the English Wikipedia. Thanks! 3tk5npgye0czb4o6ikhuf0sctsx8t9n Gebruiker:Mwpnl 2 2391 4422 2012-02-20T12:52:05Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diff=3424958 4422 wikitext text/x-wiki For more information about me or to get in touch, please visit my [[m:User:Mwpnl|User page]] and [[m:User talk:Mwpnl|talk page]] on meta-wiki. Thanks, [[m:User:Mwpnl|<font color="#2B88FE">nl:'''Mark W'''</font>]] <small>(Mwpnl) ¦ [[m:User talk:Mwpnl|<font color="#66AA33">talk</font>]]</small> is36zqujj4yd8wa9nfrj6w4wucbn3ku Gebruikerbespreking:Mwpnl 3 2392 4424 4423 2012-02-20T15:28:27Z Hoo man 599 het [["User talk:Mwpnl"]] geskuif na [[Gebruikerbespreking:Mwpnl]]: Fixing a bot error 4424 wikitext text/x-wiki For more information about me or to get in touch, please visit my [[m:User:Mwpnl|User page]] and [[m:User talk:Mwpnl|talk page]] on meta-wiki. Thanks, [[m:User:Mwpnl|<font color="#2B88FE">nl:'''Mark W'''</font>]] <small>(Mwpnl) ¦ [[m:User talk:Mwpnl|<font color="#66AA33">talk</font>]]</small> ddov55vaiv5a1vlmeso3ulm8mhvrsxp Gebruiker:Mwpnl/common.js 2 2393 4425 2012-02-21T13:01:04Z Wikitanvir 549 Creating user JS page per request 4425 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Mwpnl/global.js&action=raw&ctype=text/javascript'); a1xu2k17fjilscncb6cxhxmbeuiinbl Gebruiker:Psubhashish 2 2394 4596 4595 2012-12-27T18:26:16Z Wikitanvir 549 Editing user page on user's request 4596 wikitext text/x-wiki {{User info | full name = Subhashish Panigrahi | image name = Subhashish Panigrahi cropped.png | job title = Programme Officer | organization = [[m:India Access To Knowledge|Access To Knowledge]], [[m:w:Centre for Internet and Society (India)|Centre for Internet and Society]] | short quote = Imagine a world in which every single human being can freely share in the sum of all knowledge. Help us make it a reality! | about me = I work as a Programme Officer for Community and Program Support, [[m:India Access To Knowledge|Access To Knowledge]] for [[m:w:Centre for Internet and Society (India)|Centre for Internet and Society]]. I have a background in Business development in Corporate Communications. My personal username is found [[m:User:Psubhashish|here]]. | about my work = I'm with the [[m:India Access To Knowledge|Access To Knowledge]] [[m:Access To Knowledge/Team|team]] - and we work on supporting, building and expanding the community in India. | contact me = * E-mail: subhashish[[File:At sign.svg|17px|&nbsp;at&nbsp;|link=]]cis-india.org * English Wikipedia: [[m:en:User:Psubhashish|Psubhashish]] * Meta: [[m:User:psubhashish|Psubhashish]] }} == Details of my work == {{#babel:or|en-4|pi-1|kn-1}} My work broadly includes providing support to community in engaging new editors and supporting [[m:India Access To Knowledge|Access To Knowledge]] in terms of managing administrative and basic finance matters. ; Provided support for: * New editors on [[m:India Program/Pilot Designs/Social Media|social media]] * [[m:India Program/Outreach Programs|Outreach Programs]] * On wiki support to new editors My work details can be found under the following headers: Community and Program Support. If you still have any further questions about my work, please write to me at subhashish[[File:At sign.svg|17px|&nbsp;at&nbsp;|link=]]cis-india.org. ezvhazazj3ttsdqy5ljtcopbb89qy39 Gebruiker:MarkAHershberger 2 2395 4427 2012-02-25T05:35:04Z MarkAHershberger 915 Stuur aan na [[w:en:User:MarkAHershberger]] 4427 wikitext text/x-wiki #REDIRECT [[w:en:User:MarkAHershberger]] qcm0ai9c1jl0zbiigrstvr0nwgmtkbz Gebruiker:VasilievVV/common.js 2 2398 4432 2012-02-29T23:40:57Z VasilievVV 462 creating new JS file 4432 javascript text/javascript mw.loader.load( "//meta.wikimedia.org/w/index.php?action=raw&ctype=text/javascript&title=User:VasilievVV/global.js", "text/javascript" ); sb5332vmtmczw8e6taxjgklrcvvrtj5 Gebruikerbespreking:Snowolf 3 2400 4434 2012-03-01T16:30:30Z Quentinv57 577 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4434 wikitext text/x-wiki {| style="top:2px; width:100%; padding-bottom:0px; background:orange;" valign="middle" |- |<center><big>Page not monitored, write to [[:meta:User talk:Snowolf]] instead.</big></center> |} 0v8v947jtpxr6w6ftwv7hsdlwr8eh4y Gebruiker:MBisanz/common.js 2 2401 4435 2012-03-02T15:27:16Z Quentinv57 577 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4435 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:MBisanz/global.js&action=raw&ctype=text/javascript'); f7coylqjl911ai3ccdxujym5ympanto Gebruikerbespreking:Jan Luca 3 2406 4444 2012-03-18T02:53:26Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4444 wikitext text/x-wiki '''Please write any comment on [[m:v:de:User talk:Jan Luca|my usertalk on de.wikiversity]]''' 1bri8n55wqrqompd1tmjsk0ty0hz0us Gebruikerbespreking:Allan Javier Aguilar Castillo 3 2408 4452 2012-04-01T01:28:51Z Pathoschild 29 updated global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4452 wikitext text/x-wiki {{#babel:es-N|en-3|af-0}} [[m:w:es:Usuario Discusión:Allan Javier Aguilar Castillo|Talk to me on Spanish Wikipedia]] 0o27mt5ihn04nkdo4imwa9hyzdvuel8 Gebruiker:Tomtomn00/common.js 2 2412 4456 2012-04-03T02:10:12Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Tomtomn00]]) 4456 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Tomtomn00/global.js&action=raw&ctype=text/javascript'); 1rlhjrmntfzgsyx4nxeefb759y2k6ht Gebruikerbespreking:Tomtomn00 3 2413 4458 4457 2012-04-04T23:25:25Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Tomtomn00]]) 4458 wikitext text/x-wiki <div style="text-align:center; color:#F00; font-size:x-large;">'''See [[m:en:User talk:Tomtomn00|en]] for a faster response.'''</div> ---- 5wnezylscbm3ki3ydt3lj4tyavkf8u6 Gebruiker:Tomtomn00 2 2414 4459 2012-04-05T00:49:27Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Tomtomn00]]) 4459 wikitext text/x-wiki {{#babel:en|de-1|fr-1|lv-1|nl-2|ru-2|uk-2|ab-3|af-3|rn-2}} [[File:Redirect arrow without text.svg|46px|link=]][[m:en:User:Tomtomn00|en]] kd77rk449915j7xuetzpqb8hzsy0htx Gebruiker:Jafeluv 2 2417 4463 2012-04-05T17:16:54Z Jafeluv 519 → [[meta:User:Jafeluv]] 4463 wikitext text/x-wiki {{#babel:fi-N|af-0}} {{Softredirect|meta:User:Jafeluv}} 7gjmvxbnyvns3j1ksjnkaeibc9fzu5k Gebruiker:Thehelpfulone 2 2418 4465 2012-04-08T17:04:01Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Thehelpfulone]]) 4465 wikitext text/x-wiki Hi! Welcome to my user page, please see my [[m:User:Thehelpfulone|Meta-Wiki user page]] for more information about me. If you'd like to get in contact with me, please contact me on my [[:m:User talk:Thehelpfulone|Meta-Wiki talk page]] or by [[m:Special:EmailUser/Thehelpfulone|e-mail]]. [[User:Thehelpfulone|<font color="red">'''The'''</font>]] [[User_talk:Thehelpfulone|<font color="black"> '''Helpful'''</font>]] [[Special:Contributions/Thehelpfulone|<font color="red"> '''One'''</font>]] oegzpzbljca8w0vcsp1ivo5u15oaxxh Gebruikerbespreking:Thehelpfulone 3 2419 4466 2012-04-08T17:37:58Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Thehelpfulone]]) 4466 wikitext text/x-wiki Hi! Welcome to my user talk page, please see my [[m:User:Thehelpfulone|Meta-Wiki user page]] for more information about me. If you'd like to get in contact with me, please contact me on my [[:m:User talk:Thehelpfulone|Meta-Wiki talk page]] or by [[m:Special:EmailUser/Thehelpfulone|e-mail]]. [[User:Thehelpfulone|<font color="red">'''The'''</font>]] [[User_talk:Thehelpfulone|<font color="black"> '''Helpful'''</font>]] [[Special:Contributions/Thehelpfulone|<font color="red"> '''One'''</font>]] bb66o0o9in5auhu2oz69opie3261fvk Gebruiker:Pundit 2 2421 4470 2012-04-11T02:03:13Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diffonly=1&diff=3631030&oldid=3588687 4470 wikitext text/x-wiki {{#babel:pl|en-4|de-1|ru-1|}} <center>'''[[:m:User:Pundit|(click here for my user page on meta.wikimedia)]]'''</center> 1eio4tg200n4g0j0gxxwoeapxt6zgh7 Gebruiker:Herbythyme 2 2422 4472 2012-04-15T14:11:50Z Herbythyme 953 m 4472 wikitext text/x-wiki I am [[m:User:Herbythyme]] and I have global rights both [[m:Global rollback|rollback]] and [[m:Global sysops|sysop]]. If you have any queries about my actions it may be best to contact me on my [[m:User talk:Herbythyme|Meta talk page]], thanks. cpyf3o3b3bcf7p97jla12d514tq4kqe Gebruiker:Colourful Bling 2 2423 4473 2012-04-15T17:04:55Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Colourful Bling]]) 4473 wikitext text/x-wiki {{#babel:en|de-2|fr-3}} Hi, I'm '''Colourful Bling'''. To contact me, use my [[:m:en:User talk:Colourful Bling|talk page]] on the English Wikipedia. -- [[:m:en:User:Colourful Bling|Colourful Bling]] ([[:m:en:Special:Contributions/Colourful Bling|contribs]]) bq2eujkykpgmf22zugb47p8ph63q5b4 Boekrak:Masjienkunde 0 2425 6676 6675 2020-05-21T10:31:43Z Sakretsu 2179 rb 6676 wikitext text/x-wiki {|style="margin-bottom:1em; padding:0.4em; background-color:#f2f7ff; color:#069; border:1px solid #069; font-size:170%; width:100%" |align="left" width="100" |[[Image:Angular-contact-ball-bearing single-row din628 type-b 120.png|50px]] |align="center" width="100" |Boekrak Masjienkunde |align="right" width="100" |[[Image:Angular-contact-ball-bearing single-row din628 type-b 120.png|50px]] |} {| cellspacing="6px" | width="70%" style="border: 1px solid #6688AA; background-color:#f7f7f7; padding:0.5em;" valign="top"| <center><div style="font-size:15pt;">Afrikaanse Wikibooks met die tema van masjienkunde</div></center> | rowspan="2" width="30%" style="border: none; background-color:#f7f7f7; padding:0em;" valign="top" | {| cellspacing="0px" cellpadding="0" | style="border: 1px solid #6688AA; background-color:#f7f7f7; padding:0.5em;" valign="middle" | __TOC__ <div style="font-size:13pt;">'''Wer macht mit?'''</div> * [[Benutzer:Techni-Tom|Techni-Tom]] ** Staatlich geprüfter Techniker * [[Benutzer:BernhardQ|BernhardQ]] ** Staatlich geprüfter Techniker * <small>Wenn du beim Organisieren dieses Projektes mithelfen willst, könnte es sehr hilfreich sein, wenn du dich bei Teilnehmer einträgst, damit man dich immer kontaktieren kann.</small> <div style="font-size:13pt;">'''Planung'''</div> <small>Für ein umfassendes Regal fehlen noch einige wichtige Bücher</small> * Automatisierungstechnik * Konstruktionslehre * Maschinenelemente * Technische Komunikation <!-- * Trage hier ausschließlich solche Bücher ein, die Du selber eröffnet hast, oder die gerade in Bearbeitung sind, also schon irgendwie existieren. Wenn Du Dir ein Buch wünschst, nutze bitte die allgemeine [[Wikibooks:Wunschzettel|Wunschseite]]. <!-- * '''Einige Wünsche''' <!-- Wir hier wohl nicht gebraucht, siehe Diskussion --> |- | style="border: 1px solid #6688AA; background-color:#f7f7f7; padding:0.5em;" valign="top" | <div style="font-size:14pt;">Siehe auch</div> * [[Wikibooks:Bücherregale|Zur Übersicht über die Bücherregale]] * [[Wikibooks:Abstellraum:_Naturwissenschaften_und_Technik#Maschinenbau|Abstellraum]] * [[Wikibooks:Wunschzettel#Regal_Maschinenbau|Wunschzettel]] ---- * {{W|Portal:Maschinenbau|Wikipedia-Themenportal Maschinenbau}} * {{W|Maschinenbau|Wikipedia: Maschinenbau}} |} |---- valign="top" | width="70%" style="border: 1px solid #6688AA; background-color:#FFFFFF; padding:0.5em;" | ==Afdelings== * [[Image:1von10.png|10%]] [[Lugvaartkunde]] * [[Image:1von10.png|10%]] [[Voertuig ingenieurswese]] * [[Image:1von10.png|10%]] [[Ruimtevaartkunde]] * [[Image:1von10.png|10%]] [[Vervaardigingstegniek]] ==Ingenieursmeganika== * [[Image:0von10.png|0%]] [[Statika]] * [[Image:0von10.png|0%]] [[Dinamika]] * [[Image:0von10.png|0%]] [[Struktuurmeganika]] * [[Image:0von10.png|0%]] [[Termodinamika]] ==Materiaalkunde== * [[Image:5von10.png|50%]] [[Metale]] * [[Image:5von10.png|50%]] [[Samegestelde materiale]] ==CAD en wiskunde== * [[Image:1von10.png|10%]] [[Ing:_Wiskunde_vir_ingenieurs|Wiskunde vir ingenieurs]] {{Grafiken_geben_Fortschritt_an}} |} [[Kategorie:Regal]] [[en:Subject:Engineering]] [[ja:工学]] 4ky483li1lpv3hcemon6fxoadqn28le Gebruiker:Toto Azéro/common.js 2 2429 4480 2012-05-06T16:51:55Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Toto Azéro]]) 4480 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Toto_Azéro/global.js&action=raw&ctype=text/javascript'); etglild9qjn78ivjyk1nrudbdtw0m7z Wikibooks:Community Portal 4 2432 4485 2012-05-21T17:08:45Z Ruslik0 363 redirecting 4485 wikitext text/x-wiki #redirect [[Wikibooks:Gebruikersportaal]] f49ybj3ekjhizvzv7wtxsb2munr2vq5 Gebruiker:Guy Macon 2 2433 5632 5097 2019-05-24T02:29:03Z Guy Macon 975 Creating page -- page copied from meta doesn't have the site-specific "you are viewing a mirror site" message that I want. 5632 wikitext text/x-wiki == Guy Macon == <div style="width:100%; height:1em; clear:both;"> </div> [[File:500 x 500 SMPTE Color Bars.png|thumb|center|250px|alt=Guy Macon created this 724 byte SMPTE Color Bar image and released it to the public domain under a Creative Commons CC0 1.0 Universal Public Domain Dedication.|<span style="font-size: xx-small; float:right;">[https://creativecommons.org/publicdomain/zero/1.0/deed.en CC0] Guy Macon</span>]] <div style="width:100%; height:1em; clear:both;"> </div> <div class="center" style="width:auto; margin-left:auto; margin-right:auto;"> <code> <span style="font-size: large;">'''Guy Macon's Webpage:'''</span> <span style="font-size: large;">'''&nbsp;'''</span> <span style="font-size: large;">'''http://www.GuyMacon.com/index.html'''</span> </code> </div> <div style="width:100%; height:1em; clear:both;"> </div> <div class="center" style="width:auto; margin-left:auto; margin-right:auto;"> <code> <span style="font-size: large;">'''Guy Macon's Wikipedia Page:'''</span> <span style="font-size: large;">'''&nbsp;'''</span> <span style="font-size: large;">'''https://en.wikipedia.org/wiki/User:Guy_Macon'''</span> </code> </div> <div class="center" style="width:auto; margin-left:auto; margin-right:auto;"> <code> <span style="font-size: large;">'''Guy Macon's Wikipedia Talk Page::'''</span> <span style="font-size: large;">'''&nbsp;'''</span> <span style="font-size: large;">'''https://en.wikipedia.org/wiki/User:Guy_Macon'''</span> </code> </div> <div style="width:100%; height:1em; clear:both;"> </div> <span style="font-size: small;">If you find this page on any site other than af.wikibooks.org you are viewing a mirror site. Be aware that the page may be outdated, and that I have no affiliation with or control of mirror websites. The original page is located at [ https://af.wikibooks.org/w/index.php?title=Gebruiker:Guy_Macon ].</span> <!-- Unless otherwise specified, everything I (Guy Macon) write on Wikipedia or anywhere else on the Internet is released under the Creative Commons CC0 "No Rights Reserved" license. See http://creativecommons.org/publicdomain/zero/1.0/ and https://en.wikipedia.org/wiki/Creative_Commons_license#Zero for details. To the extent possible under law, I waive all copyright and related or neighboring rights to my work. You are free to use them for any purpose. I do NOT require you to give me credit. I would prefer that if somebody asks where you got it, you tell them, but that is up to you. You are even free to pretend you wrote it, just as everyone else is free to mock you when they find out what you did. --> <!-- Committed identity: c0c5e71bca550e99a8ae6641e66c428e232051bade39cd47355634ff159c9475fffa1d12eee339aa401bfe5b31ff7fc352c2b9c6f002bfe82d03a6b3f9e40047 is a SHA-512 commitment to this user's real-life identity. See https://en.wikipedia.org/wiki/Wikipedia:Wikipedia_Signpost/2007-05-14/Committed_identity --> 3tma4ajstwp6gp657ed7iuu9mk8h75x Gebruikerbespreking:Guy Macon 3 2434 5633 4682 2019-05-24T02:30:44Z Guy Macon 975 Better URL 5633 wikitext text/x-wiki == Wrong Place? == I prefer that messages be posted to [ https://en.wikipedia.org/wiki/User_talk:Guy_Macon ] instead of here, but if you post here I will get a weekly email notice and will eventually get back here to respond. This may take a week or two so please be patient. If you find this page on any site other than af.wikibooks.org you are viewing a mirror site. Be aware that mirror pages may be outdated, and that I have no affiliation with or control of mirror websites. The original page is located at [ https://af.wikibooks.org/w/index.php?title=Gebruikerbespreking:Guy_Macon ]. gdzewjfo48ym3hiy3lvr60ttzin6tt4 Gebruiker:Lavallen 2 2435 4492 2012-05-29T18:36:42Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diffonly=1&diff=3796945&oldid=3636963 4492 wikitext text/x-wiki {{#babel:sv|en-2|no-1|nn-1|da-1|nds-1}} [[Special:Contributions/Innocent bot|Innocent bot]]<br/> [[Special:Contributions/Innocent iwbot|Innocent iwbot]] [[File:Lavallens skugga.jpg|thumb|left|Moi]] [[sv:Användare:Lavallen]] rocy8rz6t73e90eajdsl5svxhqtarvw Gebruiker:Jasper Deng 2 2437 4525 4495 2012-07-17T02:22:17Z Jasper Deng 980 Global userpage 4525 wikitext text/x-wiki [[:w:en:User:Jasper Deng]] {{#ifeq:{{CONTENTLANGUAGE}}|en|{{#babel:en-N|fr-2}}|{{#babel:en-N|fr-2|{{CONTENTLANGUAGE}}-0}}}} __NOINDEX__ ebh8tv06p67jfaj67zzszp3bosdnxxw Gebruiker:Bill william compton/common.js 2 2438 4496 2012-06-02T15:01:16Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Bill william compton]]) 4496 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Bill_william_compton/global.js&action=raw&ctype=text/javascript'); mjptpgy7k8hn98e59mxm1lcz1y5wmgn Gebruiker:Frigotoni 2 2441 4499 2012-06-02T17:52:59Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Frigotoni]]) 4499 wikitext text/x-wiki <center>Hello, I am <span style="font-family:Bradley Hand ITC; color:black">'''Frigotoni'''</span>[[User talk:Frigotoni|<small> ...<span style="font-family:Segoe Script; color:navy" >'''i'm here'''</span></small>]]. I'm a member of the [[m:Small Wiki Monitoring Team|Small Wiki Monitoring Team]] and globally active in countervandalism. Feel free to leave me a message on [[m:User talk:Frigotoni|meta]] or on my [[m:it:Discussioni utente:Frigotoni|home]] Wiki. [[File:Face-grin.svg]]<small><br /><span class="plainlinks">[//toolserver.org/~pathoschild/crossactivity/?user=Frigotoni Crossactivity] & [//toolserver.org/~pathoschild/stalktoy/?target=Frigotoni StalkToy]</span> • If you need further information, you can click [[m:User:Frigotoni|here]]. Have I done something wrong? I apologise for this. Report it to me please.</small></center> 5w4xk8jje5ivh1j1e6b5y557pl8iowz Gebruiker:タチコマ robot 2 2442 4502 4500 2012-06-05T16:43:31Z タチコマ robot 851 r2.7.3) (robot Bygevoeg: ang, ar, az, be, bg, bn, bs, ca, cs, cv, cy, da, de, el, eo, es, et, eu, fa, fi, fr, fy, gl, he, hi, hr, hu, hy, ia, id, ie, is, it, ja, ka, kk, ko, ku, ky, la, li, lt, mg, mk, ml, mr, ms, ne, nl, no, oc, pa, pl, pt, ro, r... 4502 wikitext text/x-wiki {{Bot|とある白い猫|site=meta}} {{Emergency-bot-shutoff}} [[ang:User:タチコマ robot]] [[ar:مستخدم:タチコマ robot]] [[az:İstifadəçi:タチコマ robot]] [[be:Удзельнік:タチコマ robot]] [[bg:Потребител:タチコマ robot]] [[bn:ব্যবহারকারী:タチコマ robot]] [[bs:Korisnik:タチコマ robot]] [[ca:Usuari:タチコマ robot]] [[cs:Uživatel:タチコマ robot]] [[cv:Хутшăнакан:タチコマ robot]] [[cy:Defnyddiwr:タチコマ robot]] [[da:Bruger:タチコマ robot]] [[de:Benutzer:タチコマ robot]] [[el:Χρήστης:タチコマ robot]] [[en:User:タチコマ robot]] [[eo:Uzanto:タチコマ robot]] [[es:Usuario:タチコマ robot]] [[et:Kasutaja:タチコマ robot]] [[eu:Lankide:タチコマ robot]] [[fa:کاربر:タチコマ robot]] [[fi:Käyttäjä:タチコマ robot]] [[fr:Utilisateur:タチコマ robot]] [[fy:Meidogger:タチコマ robot]] [[gl:Usuario:タチコマ robot]] [[he:משתמש:タチコマ robot]] [[hi:सदस्य:タチコマ robot]] [[hr:Suradnik:タチコマ robot]] [[hu:Szerkesztő:タチコマ robot]] [[hy:Մասնակից:タチコマ robot]] [[ia:Usator:タチコマ robot]] [[id:Pengguna:タチコマ robot]] [[ie:Usator:タチコマ robot]] [[is:Notandi:タチコマ robot]] [[it:Utente:タチコマ robot]] [[ja:利用者:タチコマ robot]] [[ka:მომხმარებელი:タチコマ robot]] [[kk:Қатысушы:タチコマ robot]] [[ko:사용자:タチコマ robot]] [[ku:Bikarhêner:タチコマ robot]] [[ky:Колдонуучу:タチコマ robot]] [[la:Usor:タチコマ robot]] [[li:Gebroeker:タチコマ robot]] [[lt:Naudotojas:タチコマ robot]] [[mg:Mpikambana:タチコマ robot]] [[mk:Корисник:タチコマ robot]] [[ml:ഉപയോക്താവ്:タチコマ robot]] [[mr:सदस्य:タチコマ robot]] [[ms:Pengguna:タチコマ robot]] [[ne:प्रयोगकर्ता:タチコマ robot]] [[nl:Gebruiker:タチコマ robot]] [[no:Bruker:タチコマ robot]] [[oc:Utilizaire:タチコマ robot]] [[pa:ਮੈਂਬਰ:タチコマ robot]] [[pl:Wikipedysta:タチコマ robot]] [[pt:Utilizador:タチコマ robot]] [[ro:Utilizator:タチコマ robot]] [[ru:Участник:タチコマ robot]] [[sa:योजकः:タチコマ robot]] [[si:පරිශීලක:タチコマ robot]] [[sk:Redaktor:タチコマ robot]] [[sl:Uporabnik:タチコマ robot]] [[sq:Përdoruesi:タチコマ robot]] [[sr:Корисник:タチコマ robot]] [[su:Pamaké:タチコマ robot]] [[sv:Användare:タチコマ robot]] [[ta:பயனர்:タチコマ robot]] [[te:వాడుకరి:タチコマ robot]] [[tg:Корбар:タチコマ robot]] [[th:ผู้ใช้:タチコマ robot]] [[tk:Ulanyjy:タチコマ robot]] [[tl:Tagagamit:タチコマ robot]] [[tr:Kullanıcı:タチコマ robot]] [[tt:Кулланучы:タチコマ robot]] [[uk:Користувач:タチコマ robot]] [[ur:صارف:タチコマ robot]] [[uz:Foydalanuvchi:タチコマ robot]] [[vi:Thành viên:タチコマ robot]] [[vo:Geban:タチコマ robot]] [[zh:User:タチコマ robot]] [[zh-min-nan:User:タチコマ robot]] kjqjwav8avcfrmga41aj75551uwiv9d Gebruikerbespreking:タチコマ robot 3 2443 4501 2012-06-05T10:03:03Z タチコマ robot 851 Create 4501 wikitext text/x-wiki #REDIRECT [[User talk:とある白い猫]] kkrg56volz0eoyi7rc9seh78x9sdbsx Gebruiker:とある白い猫 2 2444 4505 4503 2012-06-05T22:13:30Z タチコマ robot 851 r2.7.3) (robot Bygevoeg: ang, ar, az, be, bg, bn, bs, ca, cs, cv, cy, da, de, el, eo, es, et, eu, fa, fi, fr, fy, gl, he, hi, hr, hu, hy, ia, id, ie, is, it, ja, ka, kk, ko, ku, ky, la, li, lt, mg, mk, ml, mr, ms, ne, nl, no, oc, pa, pl, pt, ro, r... 4505 wikitext text/x-wiki :<small>''This is the user page of [[Meta:User:とある白い猫]]''</small> ---- {{/af}} [[ang:User:とある白い猫]] [[ar:مستخدم:とある白い猫]] [[az:İstifadəçi:とある白い猫]] [[be:Удзельнік:とある白い猫]] [[bg:Потребител:とある白い猫]] [[bn:ব্যবহারকারী:とある白い猫]] [[bs:Korisnik:とある白い猫]] [[ca:Usuari:とある白い猫]] [[cs:Uživatel:とある白い猫]] [[cv:Хутшăнакан:とある白い猫]] [[cy:Defnyddiwr:とある白い猫]] [[da:Bruger:とある白い猫]] [[de:Benutzer:とある白い猫]] [[el:Χρήστης:とある白い猫]] [[en:User:とある白い猫]] [[eo:Uzanto:とある白い猫]] [[es:Usuario:とある白い猫]] [[et:Kasutaja:とある白い猫]] [[eu:Lankide:とある白い猫]] [[fa:کاربر:とある白い猫]] [[fi:Käyttäjä:とある白い猫]] [[fr:Utilisateur:とある白い猫]] [[fy:Meidogger:とある白い猫]] [[gl:Usuario:とある白い猫]] [[he:משתמש:とある白い猫]] [[hi:सदस्य:とある白い猫]] [[hr:Suradnik:とある白い猫]] [[hu:Szerkesztő:とある白い猫]] [[hy:Մասնակից:とある白い猫]] [[ia:Usator:とある白い猫]] [[id:Pengguna:とある白い猫]] [[ie:Usator:とある白い猫]] [[is:Notandi:とある白い猫]] [[it:Utente:とある白い猫]] [[ja:利用者:とある白い猫]] [[ka:მომხმარებელი:とある白い猫]] [[kk:Қатысушы:とある白い猫]] [[ko:사용자:とある白い猫]] [[ku:Bikarhêner:とある白い猫]] [[ky:Колдонуучу:とある白い猫]] [[la:Usor:とある白い猫]] [[li:Gebroeker:とある白い猫]] [[lt:Naudotojas:とある白い猫]] [[mg:Mpikambana:とある白い猫]] [[mk:Корисник:とある白い猫]] [[ml:ഉപയോക്താവ്:とある白い猫]] [[mr:सदस्य:とある白い猫]] [[ms:Pengguna:とある白い猫]] [[ne:प्रयोगकर्ता:とある白い猫]] [[nl:Gebruiker:とある白い猫]] [[no:Bruker:とある白い猫]] [[oc:Utilizaire:とある白い猫]] [[pa:ਮੈਂਬਰ:とある白い猫]] [[pl:Wikipedysta:とある白い猫]] [[pt:Utilizador:とある白い猫]] [[ro:Utilizator:とある白い猫]] [[ru:Участник:とある白い猫]] [[sa:योजकः:とある白い猫]] [[si:පරිශීලක:とある白い猫]] [[sk:Redaktor:とある白い猫]] [[sl:Uporabnik:とある白い猫]] [[sq:Përdoruesi:とある白い猫]] [[sr:Корисник:とある白い猫]] [[su:Pamaké:とある白い猫]] [[sv:Användare:とある白い猫]] [[ta:பயனர்:とある白い猫]] [[te:వాడుకరి:とある白い猫]] [[tg:Корбар:とある白い猫]] [[th:ผู้ใช้:とある白い猫]] [[tl:Tagagamit:とある白い猫]] [[tr:Kullanıcı:とある白い猫]] [[tt:Кулланучы:とある白い猫]] [[uk:Користувач:とある白い猫]] [[ur:صارف:とある白い猫]] [[uz:Foydalanuvchi:とある白い猫]] [[vi:Thành viên:とある白い猫]] [[vo:Geban:とある白い猫]] [[zh:User:とある白い猫]] [[zh-min-nan:User:とある白い猫]] h5v3z8mrvfpwoeo9h17l7i9pypjzowc Gebruikerbespreking:とある白い猫 3 2445 4504 2012-06-05T21:54:59Z タチコマ robot 851 Create 4504 wikitext text/x-wiki :<small>''This is the user talk page of [[Meta:User talk:とある白い猫]]''</small> ---- {{/af}} =Posts= rwqqk476ygpccuse5sscl1rrbeoe2d5 Gebruiker:JYBot 2 2446 4506 2012-06-10T11:50:46Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diff=3797849&oldid=3796945 4506 wikitext text/x-wiki {{Bot|javadyou|site=fa}}<br>[[:w:fa:user:Javadyou|Javayou userpage on fa.wiki]] 1tp7ey17ytxao5zisj9k4jvyafgk9v3 Gebruiker:DarafshBot 2 2447 4507 2012-06-10T11:59:18Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diff=3820171&oldid=3820061 4507 wikitext text/x-wiki {{Bot|درفش کاویانی|site=fa}}<br>[[:w:fa:user:درفش کاویانی|Javayou userpage on fa.wiki]] qbleofuh460cbnj98uoasrhk4veoij3 Gebruiker:とある白い猫/common.js 2 2448 4508 2012-06-11T01:31:08Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by とある白い猫]]) 4508 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:とある白い猫/global.js&action=raw&ctype=text/javascript'); demytpwy3j0kikuliopbe5oi6sufviy Gebruiker:Σ/common.js 2 2451 4512 2012-06-18T04:12:18Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Σ]]) 4512 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Σ/global.js&action=raw&ctype=text/javascript'); sek291bim4m77l7h0nbx6kyxp0ozaje Gebruiker:JAn Dudík 2 2453 4514 2012-06-24T20:39:35Z JAn Dudík 998 Nuwe bladsy geskep met 'Owner of [[User:JAnDbot]] from cs.wiki. Please, contact me on my [[w:cs:Wikipedista diskuse:JAn Dudík|czech talk page]].' 4514 wikitext text/x-wiki Owner of [[User:JAnDbot]] from cs.wiki. Please, contact me on my [[w:cs:Wikipedista diskuse:JAn Dudík|czech talk page]]. j54m1t4gjn0zos0bdprynycbkhuft0a Gebruiker:Zscout370 2 2454 4515 2012-06-25T22:30:49Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diff=3800927 4515 wikitext text/x-wiki [[w:en:User:Zscout370|Zscout370]] 88eioklo2l6a0lkomuepwxcw2agm36e Gebruiker:Mathonius 2 2461 4524 2012-07-14T14:03:19Z Mathonius 722 Nuwe bladsy geskep met '{{#Babel:nl|en-3|fr-1|de-1|{{subst:CONTENTLANGUAGE}}-0}} <center>''I'm a member of the [[:m:SWMT|Small Wiki Monitoring Team]]. See [[:sulutil:Mathonius]] for more informa...' 4524 wikitext text/x-wiki {{#Babel:nl|en-3|fr-1|de-1|af-0}} <center>''I'm a member of the [[:m:SWMT|Small Wiki Monitoring Team]]. See [[:sulutil:Mathonius]] for more information. Feel free to leave me a message on [[:User talk:Mathonius|my talk page]].''<br />[[:m:User:Mathonius|(click here for my user page on meta.wikimedia)]]</center> ---- phpzlezpw5ci733h3rvbadmuzs06drm Gebruikerbespreking:Vogone 3 2465 4532 2012-08-04T20:18:52Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Vogone]]) 4532 wikitext text/x-wiki #REDIRECT [[User:Vogone]] 9r3idjrvf2ajcaaq3mc8x7e2z9vb90w Gebruiker:Lixer 2 2468 4535 2012-08-06T09:23:18Z Lixer 1031 Nuwe bladsy geskep met '{{Babel|sv|en-2|no-2|da-2|nn-1|fi-1|{{CONTENTLANGUAGE}}-0}} '''Lixer''', Swedish user from the Swedish Wikipedia. I will probably not be active here. Please leave a mes...' 4535 wikitext text/x-wiki {{Babel|sv|en-2|no-2|da-2|nn-1|fi-1|{{CONTENTLANGUAGE}}-0}} '''Lixer''', Swedish user from the Swedish Wikipedia. I will probably not be active here. Please leave a message on my talk page if you want something. If you need a quick response, you should contact me on my Swedish talk page or my English talk page. ----- [[File:Animated-Flag-Sweden.gif|45px]] [http://sv.wikipedia.org/wiki/Anv%C3%A4ndare:Lixer Swedish Wikipedia] ([http://sv.wikipedia.org/wiki/Anv%C3%A4ndardiskussion:Lixer Talk]) [[File:Animated-Flag-United-Kingdom.gif|45px]] [http://en.wikipedia.org/wiki/User:Lixer English Wikipedia] ([http://en.wikipedia.org/wiki/User_talk:Lixer Talk]) ----- qnap53nwxzwd9e01begpyg1p8iz68rn Gebruiker:Osiris 2 2469 4536 2012-08-07T22:47:50Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Osiris]]) 4536 wikitext text/x-wiki Hello! I am <span class="plainlinks userlinks">[[User:Osiris|Osiris]] ([[User talk:Osiris|talk]] · [[Special:Contributions/Osiris|contribs]] · [[Special:DeletedContributions/Osiris|deleted contribs]] · [{{fullurl:Special:Log|user=Osiris}} logs] · [{{fullurl:Special:AbuseLog|wpSearchUser=Osiris}} edit filter log] · [[Special:Block/Osiris|block user]] · [{{fullurl:Special:Log|type=block&page=User:Osiris}} block log])</span>. Most of my activity on this project will be related to patrolling recent changes and reverting vandalism. You will find me most active on the [[w:en:User talk:Osiris|English]] and [[w:simple:User talk:Osiris|Simple English Wikipedias]], [[commons:User talk:Osiris|Commons]], [[m:User talk:Osiris|Meta]] and [[incubator:User talk:Osiris|Incubator]]. You can post to my talk page here, but I might be slow in replying. afipsvbpoyfq1p4ynv7lj0kn08mjlg2 Gebruikerbespreking:Jitrixis 3 2474 4549 4546 2012-08-21T20:31:33Z Jitrixis 1045 4549 wikitext text/x-wiki <center><table style="width:95%;border-style:solid;border-radius:10px;background-color:{{User:Jitrixis|cadre}};border-color:{{User:Jitrixis|bordure}};"> <tr> <td style="width:25%;padding:20px;color:red"><center><big><big>'''This user doesn't speak very well your language.'''</big></big><br/><br/>But he can speak another language (see Babel).</center><br/>→ <span class="plainlinks">[http://en.wikipedia.org/wiki/User:Jitrixis Main page in english]</span><br/>→ <span class="plainlinks">[http://fr.wikipedia.org/wiki/Utilisateur:Jitrixis Main page in french]</span><br/>→ <span class="plainlinks">[http://fr.wikipedia.org/wiki/Discussion_utilisateur:Jitrixis Talk page in multilinguage]</span></td> <td style="width:50%;padding:20px"><center><big><big>{{User:Jitrixis|nom|trad}} '''[[Julien]] G.''' aka '''Jitrixis'''</big></big><br/><br/> Ma langue maternelle est le '''Français''', but I'm able to speek with an advanced level of '''English''' und Ich kann sprechen ein wenig '''Deutsch'''. {{User:Jitrixis|nee|trad}}. </center></td> <td style="width:25%"><center>{{#babel:{{User:Jitrixis|lang|trad}}-0|fr|en-3|de-1}}</center></td> </tr> <tr> <td colspan="3"><center><table class="wikitable centre" style="width:80%;border:1px black;"> <tr> <td style="border-color:{{User:Jitrixis|bordure}};width:100%;text-align:center;vertical-align:middle;background-color:{{User:Jitrixis|onglets}}"> <big>'''<span class="plainlinks">[http://fr.wikipedia.org/w/index.php?title=Discussion_utilisateur:{{PAGENAMEE}}&action=edit&section=new <span style="color:{{User:Jitrixis/Couleurs|police}}">New Section</span></span>'''</big> </td> </tr> </table></center></td> </tr> </table></center> <center><table class="wikitable centre" style="border-radius:8px;width:80%;border:1px black;"> <tr> <td style="border-color:{{User:Jitrixis|bordure}};width:100%;text-align:center;vertical-align:middle;color:red;background-color:{{User:Jitrixis|cadre}}"> <big><big>[[File:Nuvola apps important.svg|90px|right]][[File:Nuvola apps important.svg|90px|left]]'''Thank you to writing nothing on this page.'''</big> By clicking on new section you will be redirected on the French talk page of Jitrixis. However you can still writing your messages in English or in another language which he understands.</big> </td> </tr> </table></center> a9d6owf3cxm4jxz33q5rqezzqcaft5s Gebruikerbespreking:Avocato 3 2476 4552 2012-08-30T19:49:38Z Avocato 800 Creating 4552 wikitext text/x-wiki <div dir=ltr><div style="background: #FFFFFF; text-align: center; font-family: Calibri; font-size: 1.6em; font-weight: bold;"><div style="padding: 5px; border: 3px solid #003882; -moz-border-radius: 10px; -webkit-border-radius: 10px; border-radius: 10px;">Please, Do not leave your message here. You can contact me using any of the following: <div style="margin-top: 10px; padding: 2px; background: #f4f3f0; border: 2px solid #fb139e; -moz-border-radius: 10px; -webkit-border-radius: 10px; border-radius: 10px;">[[w:ar:User talk:Avocato|w:ar:user talk:Avocato]] &#124; [[w:en:User talk:Avocato|w:en:user talk:Avocato]] &#124; [[m:User talk:Avocato|meta:user talk:Avocato]]</div></div></div></div> 3hadats3wp6ted874jwt08stykc5rdi Gebruiker:AvocatoBot 2 2477 4560 4553 2012-09-08T09:42:35Z AvocatoBot 832 r2.7.3) (robot Bygevoeg: ang, az, be, bg, bn, bs, ca, cs, cv, cy, da, de, el, en, eo, es, et, eu, fa, fi, fr, fy, gl, he, hi, hr, hu, hy, ia, id, ie, is, it, ja, ka, kk, ko, ku, ky, la, li, lt, mg, mk, ml, mr, ms, ne, nl, no, oc, pa, pl, pt, ro, ru, sa... 4560 wikitext text/x-wiki <div dir=ltr> {| width="80%" align="center" style="text-align:justify; border:1px solid #aaaaaa; background-color:#f9f9f9; color:#000000;" |- padding:1em;padding-top:0.5em;padding-right:2em;padding-left:3em" |[[File:Crystal Clear action run.svg|60px|link=]] |'''This user account is a [[w:en:Wikipedia:Bot policy|bot]] operated by [[w:ar:مستخدم:Avocato|Avocato]] ([[w:ar:نقاش المستخدم:Avocato|talk]]).'''<br /> It is a legitimate alternative account, used to make repetitive automated or semi-automated edits that would be extremely tedious to do manually. |} </div> [[ang:User:AvocatoBot]] [[ar:مستخدم:AvocatoBot]] [[az:İstifadəçi:AvocatoBot]] [[be:Удзельнік:AvocatoBot]] [[bg:Потребител:AvocatoBot]] [[bn:ব্যবহারকারী:AvocatoBot]] [[bs:Korisnik:AvocatoBot]] [[ca:Usuari:AvocatoBot]] [[cs:Uživatel:AvocatoBot]] [[cv:Хутшăнакан:AvocatoBot]] [[cy:Defnyddiwr:AvocatoBot]] [[da:Bruger:AvocatoBot]] [[de:Benutzer:AvocatoBot]] [[el:Χρήστης:AvocatoBot]] [[en:User:AvocatoBot]] [[eo:Uzanto:AvocatoBot]] [[es:Usuario:AvocatoBot]] [[et:Kasutaja:AvocatoBot]] [[eu:Lankide:AvocatoBot]] [[fa:کاربر:AvocatoBot]] [[fi:Käyttäjä:AvocatoBot]] [[fr:Utilisateur:AvocatoBot]] [[fy:Meidogger:AvocatoBot]] [[gl:Usuario:AvocatoBot]] [[he:משתמש:AvocatoBot]] [[hi:सदस्य:AvocatoBot]] [[hr:Suradnik:AvocatoBot]] [[hu:Szerkesztő:AvocatoBot]] [[hy:Մասնակից:AvocatoBot]] [[ia:Usator:AvocatoBot]] [[id:Pengguna:AvocatoBot]] [[ie:Usator:AvocatoBot]] [[is:Notandi:AvocatoBot]] [[it:Utente:AvocatoBot]] [[ja:利用者:AvocatoBot]] [[ka:მომხმარებელი:AvocatoBot]] [[kk:Қатысушы:AvocatoBot]] [[ko:사용자:AvocatoBot]] [[ku:Bikarhêner:AvocatoBot]] [[ky:Колдонуучу:AvocatoBot]] [[la:Usor:AvocatoBot]] [[li:Gebroeker:AvocatoBot]] [[lt:Naudotojas:AvocatoBot]] [[mg:Mpikambana:AvocatoBot]] [[mk:Корисник:AvocatoBot]] [[ml:ഉപയോക്താവ്:AvocatoBot]] [[mr:सदस्य:AvocatoBot]] [[ms:Pengguna:AvocatoBot]] [[ne:प्रयोगकर्ता:AvocatoBot]] [[nl:Gebruiker:AvocatoBot]] [[no:Bruker:AvocatoBot]] [[oc:Utilizaire:AvocatoBot]] [[pa:ਮੈਂਬਰ:AvocatoBot]] [[pl:Wikipedysta:AvocatoBot]] [[pt:Utilizador:AvocatoBot]] [[ro:Utilizator:AvocatoBot]] [[ru:Участник:AvocatoBot]] [[sa:योजकः:AvocatoBot]] [[si:පරිශීලක:AvocatoBot]] [[sk:Redaktor:AvocatoBot]] [[sl:Uporabnik:AvocatoBot]] [[sq:Përdoruesi:AvocatoBot]] [[sr:Корисник:AvocatoBot]] [[sv:Användare:AvocatoBot]] [[ta:பயனர்:AvocatoBot]] [[te:వాడుకరి:AvocatoBot]] [[tg:Корбар:AvocatoBot]] [[th:ผู้ใช้:AvocatoBot]] [[tl:Tagagamit:AvocatoBot]] [[tr:Kullanıcı:AvocatoBot]] [[tt:Кулланучы:AvocatoBot]] [[uk:Користувач:AvocatoBot]] [[ur:صارف:AvocatoBot]] [[uz:Foydalanuvchi:AvocatoBot]] [[vi:Thành viên:AvocatoBot]] [[zh:User:AvocatoBot]] [[zh-min-nan:User:AvocatoBot]] 7vbay4zq2x71tc7zhtgkwoaw7mt42zv Gebruikerbespreking:AvocatoBot 3 2478 4554 2012-08-31T19:42:09Z AvocatoBot 832 Creating 4554 wikitext text/x-wiki <div dir=ltr><div style="background: #FFFFFF; text-align: center; font-family: Calibri; font-size: 1.6em; font-weight: bold;"><div style="padding: 5px; border: 3px solid #003882; -moz-border-radius: 10px; -webkit-border-radius: 10px; border-radius: 10px;">Please, Do not leave your message here. You can contact my operator using any of the following: <div style="margin-top: 10px; padding: 2px; background: #f4f3f0; border: 2px solid #fb139e; -moz-border-radius: 10px; -webkit-border-radius: 10px; border-radius: 10px;">[[w:ar:User talk:Avocato|w:ar:user talk:Avocato]] &#124; [[w:en:User talk:Avocato|w:en:user talk:Avocato]] &#124; [[m:User talk:Avocato|meta:user talk:Avocato]]</div></div></div></div> sp61nkc3vi6lvhlea1ecl2bxwlit01z Gebruiker:Antonorsi 2 2479 4555 2012-09-02T23:05:14Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Antonorsi]]) 4555 wikitext text/x-wiki {{#babel:es|en-3|af-0}} ''Hello, I'm [[:m:User:Antonorsi|Antonorsi]], from es.wiki. You can contact me in [[:m:User talk:Antonorsi|my talk page on meta]].''<br /> ---- la2o3unoppacpx7uvuxy7ng029tqpz2 Gebruiker:Shujenchang/common.js 2 2481 4557 2012-09-03T00:41:05Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Shujenchang]]) 4557 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Shujenchang/global.js&action=raw&ctype=text/javascript'); qrhxsoxscudtwxlfngb7psz1fhrepcr Gebruiker:Lukas²³/common.js 2 2482 4558 2012-09-03T01:48:02Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Lukas²³]]) 4558 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Lukas²³/global.js&action=raw&ctype=text/javascript'); 83yd8rgqpt0d0uokqpva51quireg5a7 Gebruiker:Noommos/common.js 2 2483 4564 2012-09-20T19:26:51Z Noommos 1068 Creating javascript (SWMT) 4564 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Noommos/global.js&action=raw&ctype=text/javascript'); heon0uvy8qznbjj7gzy0htsedh4nvuy Gebruikerbespreking:Moe Epsilon 3 2484 4679 4569 2013-06-21T13:30:34Z Moe Epsilon 156 + 4679 wikitext text/x-wiki {{Gebruikerbespreking:Moe Epsilon/Header}} 23w06l1i956x45wckmfwae2pnldl405 Gebruiker:Translation Notification Bot 2 2486 4571 2012-10-25T18:32:18Z Quentinv57 577 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4571 wikitext text/x-wiki <div style="min-height: 57px; border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 50%; margin: 0 auto 1em auto; padding: .2em; text-align: justify;"> <div style="float: left">[[File:Wikimedia Community Logo.svg|50px|link=]]</div> <div style="margin-left: 60px">'''[[:m:User:Translation Notification Bot|m:User:Translation Notification Bot]]'''.<br />(''[[m:Interwiki redirect|{{int:redirectpagesub}}]]'')</div> </div> 59xrrxfkj8xh7jw11em0s4rnuulbz9j Gebruiker:Shujenchang 2 2487 4572 2012-10-26T08:17:14Z Quentinv57 577 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4572 wikitext text/x-wiki {{#babel:zh|en-4|zh-classical-2|eo-1|ko-1|ja-0|fr-0||af-0}} Sometimes this user works as a member of [[m:Small Wiki Monitoring Team|SWMT]] and helps some anti-vandalism and anti-spam works here. To know more about this user, you can see his user page on [[w:en:User:Shujenchang|English Wikipedia]]. You can contact him via [[User talk:Shujenchang|talk page]], [[w:en:Special:EmailUser/Shujenchang|email]] or [[w:en:User:Shujenchang/Contact#IMs|IMs]] (Note: Please use English). '''Note''': Because of this user perhaps do not know the language on this project totally, so may be sometimes he will do something wrong when he do anti-vandalism and anti-spam works. If he did something wrong, please [[User talk:Shujenchang|let him know]]. aoly2vl61ss8soar3ejpylr17hr95bb Gebruiker:Mr.Ajedrez 2 2488 4573 2012-10-26T09:12:40Z Quentinv57 577 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4573 wikitext text/x-wiki {{#babel:es|ast|en-3|fr-2|af-0}} ''Hello, I'm [[:w:es:User:Mr.Ajedrez|Mr.Ajedrez]], from es.wiki. You can contact me in [[:w:es:User talk:Mr.Ajedrez|my talk page in es.wiki]].''<br /> ---- 62ush3sasp6nbrual8xx4g6cyfyqysy Gebruiker:ChessBOT 2 2489 4574 2012-10-26T09:12:49Z Quentinv57 577 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by user]]) 4574 wikitext text/x-wiki {{bot|Mr.Ajedrez|site=w:es}} pp903u1bf9hm4qev44qoez4ypbpdb73 Gebruiker:Mabifixem 2 2490 4576 2012-11-07T09:31:32Z 80.156.44.178 init 4576 wikitext text/x-wiki [[Image:Alien-hack-master.png|100px]] [[File:Redirectltr.png]]<b>[[:fr:Utilisateur:Mabifixem|Mabifixem]]</b> 50dnopl8mroj7uotuw2w7ef0idyg2bj Gebruiker:Sotiale/common.js 2 2492 4587 2012-12-09T22:17:42Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Sotiale]]) 4587 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Sotiale/global.js&action=raw&ctype=text/javascript'); 03gc5bhcnt2oox5rx9ogo1n6m4nvu95 Gebruiker:Salvio giuliano/common.js 2 2493 4588 2012-12-10T03:35:54Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Salvio giuliano]]) 4588 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Salvio giuliano/global.js&action=raw&ctype=text/javascript'); cilyqrty5clt7jy7sq0jqp3ujg4euh1 Gebruiker:Base/vector.js 2 2495 4590 2012-12-11T18:49:23Z Base 1005 creating new ownjs page 4590 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Base/global.js&action=raw&ctype=text/javascript'); 9giyxj7vuxbzl3gw9t8r2790bzkcnaa Gebruiker:Makecat 2 2497 5242 4593 2017-04-04T01:21:55Z CommonsDelinker 24 Replacing File-Ngc5866_hst_big.png with [[File:Ngc5866_hst_big.png]] (by [[:c:User:CommonsDelinker|CommonsDelinker]] because: [[:c:COM:FR|File renamed]]: [[:c:COM:FR#reasons|File renaming criterion #6]]: Non-controversial maintenance and bug fixes, includ 5242 wikitext text/x-wiki <div style="margin-left:-1em; margin-right:-1em; margin-bottom:15em;" class="plainlinks"> <div style="padding:0px; background:#99CCCC; border:1px solid #42526C; font-family:Calibri; color:#AAA;"> {| style="border:1px solid #99CCCC; background:#99CCCC; color:#333333;" align="center" |- style="padding:1em;" | width="17%" | <div style="padding:0.5em; margin:0.5em; width:200px; float:left;">[[File:Ngc5866 hst big.png|200px]]</div> | {{#Babel:zh|en-2}} <big>Hello, I am '''Makecat'''. I am an [[w:zh:Wikipedia:管理员|administrator]] on the Chinese Wikipedia, which is my home wiki. I am a member of [[m:SWMT|Small Wiki Monitoring Team]] and may make some edits here occasionally, such as reverting vandalism and requesting pages for speedy deletion. If you want to contact me, please leave a message at [[w:zh:User talk:Makecat|here]].</big> |} </div> </div> [[en:User:Makecat]] [[zh:User:Makecat]] b2u9kso1moq7ec4u7cx2unvgq97vewy Bespreking:Hoërskool Natuur- en Skeikunde/Deel 1-4: Materie en Materiale 1 2500 5694 5678 2019-10-12T16:55:21Z Minorax 2092 Undid edits by [[Special:Contribs/37.154.185.126|37.154.185.126]] ([[User talk:37.154.185.126|talk]]) to last version by 41.185.144.4 5694 wikitext text/x-wiki Is koek 'n suiwer stof of 'n mengsel? 72nxjb0t791jeiw4ak3q2m3m7dvzlja Gebruikerbespreking:AmandaNP 3 2502 6689 4611 2020-06-26T10:19:15Z Sakretsu 2179 Sakretsu het bladsy [[Gebruikerbespreking:DeltaQuad]] na [[Gebruikerbespreking:AmandaNP]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/DeltaQuad|DeltaQuad]]" to "[[Special:CentralAuth/AmandaNP|AmandaNP]]" 4611 wikitext text/x-wiki #REDIRECT [[m:User talk:DeltaQuad]] hx582ovme1j4qgwq2pp7qrvxx5iap4c Gebruiker:Yethrosh 2 2504 5648 4613 2019-07-20T00:12:36Z Ejs-80 1564 Ejs-80 het bladsy [[Gebruiker:محمد شعیب]] na [[Gebruiker:Yethrosh]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/محمد شعیب|محمد شعیب]]" to "[[Special:CentralAuth/Yethrosh|Yethrosh]]" 4613 wikitext text/x-wiki #REDIRECT [[ur:User talk:محمد شعیب]] fpj2rfbakrb6r7d9uc8reqq7szgsp8m Gebruikerbespreking:Yethrosh 3 2505 5647 4614 2019-07-20T00:12:36Z Ejs-80 1564 Ejs-80 het bladsy [[Gebruikerbespreking:محمد شعیب]] na [[Gebruikerbespreking:Yethrosh]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/محمد شعیب|محمد شعیب]]" to "[[Special:CentralAuth/Yethrosh|Yethrosh]]" 4614 wikitext text/x-wiki #REDIRECT [[ur:User talk:محمد شعیب]] fpj2rfbakrb6r7d9uc8reqq7szgsp8m Gebruiker:Base/vector.css 2 2506 4615 2013-02-03T16:33:12Z Base 1005 Global CSS creation/upgrade 4615 css text/css @import url('http://meta.wikimedia.org/w/index.php?title=User:Base/global.css&action=raw&ctype=text/css'); 0ad8lnwox1r6cybruweme61168kinbz Gebruiker:Green Mostaza/common.js 2 2507 5235 4928 2017-02-16T11:55:05Z Savh 636 Savh het bladsy [[Gebruiker:Allan Aguilar/common.js]] na [[Gebruiker:Green Mostaza/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Allan Aguilar|Allan Aguilar]]" to "[[Special:CentralAuth/Green Mostaza|Green... 5235 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Ralgis/global.js&action=raw&ctype=text/javascript'); oo0enx1togksp1hr5zyhtjklhr9da8p Gebruiker:Gwickwire/common.js 2 2508 4618 2013-02-05T03:28:06Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Gwickwire]]) 4618 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Gwickwire/global.js&action=raw&ctype=text/javascript'); oaavw6b7a7c9mzidklcpj7cy103llx9 Gebruiker:Sumone10154/common.js 2 2509 4622 2013-02-18T01:06:10Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Sumone10154]]) 4622 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Sumone10154/global.js&action=raw&ctype=text/javascript'); 3kscmjhjt7420t3gpmzm2hurkmq8zey Gebruiker:Meisam/common.js 2 2510 4623 2013-02-18T02:40:22Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Meisam]]) 4623 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Meisam/global.js&action=raw&ctype=text/javascript'); q97zabc65asw699merw8wy1dbbqvvpq Gebruiker:MahdiBot 2 2511 4625 4624 2013-02-18T23:30:12Z Hoo User Page Bot 827 per hand fix 4625 wikitext text/x-wiki {{Bot|Mahdiz|site=fa}} [[ab:user:MahdiBot]] [[ace:user:MahdiBot]] [[af:user:MahdiBot]] [[ak:user:MahdiBot]] [[als:user:MahdiBot]] [[am:user:MahdiBot]] [[ang:user:MahdiBot]] [[an:user:MahdiBot]] [[arc:user:MahdiBot]] [[ar:user:MahdiBot]] [[arz:user:MahdiBot]] [[ast:user:MahdiBot]] [[as:user:MahdiBot]] [[av:user:MahdiBot]] [[ay:user:MahdiBot]] [[az:user:MahdiBot]] [[bar:user:MahdiBot]] [[bat-smg:user:MahdiBot]] [[ba:user:MahdiBot]] [[bcl:user:MahdiBot]] [[be:user:MahdiBot]] [[be-x-old:user:MahdiBot]] [[bg:user:MahdiBot]] [[bh:user:MahdiBot]] [[bi:user:MahdiBot]] [[bjn:user:MahdiBot]] [[bm:user:MahdiBot]] [[bug:user:MahdiBot]] [[bxr:user:MahdiBot]] [[cbk-zam:user:MahdiBot]] [[cdo:user:MahdiBot]] [[ceb:user:MahdiBot]] [[ce:user:MahdiBot]] [[chr:user:MahdiBot]] [[ch:user:MahdiBot]] [[chy:user:MahdiBot]] [[ckb:user:MahdiBot]] [[co:user:MahdiBot]] [[crh:user:MahdiBot]] [[cr:user:MahdiBot]] [[csb:user:MahdiBot]] [[cs:user:MahdiBot]] [[cu:user:MahdiBot]] [[cv:user:MahdiBot]] [[cy:user:MahdiBot]] [[da:user:MahdiBot]] [[de:user:MahdiBot]] [[diq:user:MahdiBot]] [[dsb:user:MahdiBot]] [[dv:user:MahdiBot]] [[dz:user:MahdiBot]] [[ee:user:MahdiBot]] [[en:user:MahdiBot]] [[el:user:MahdiBot]] [[eml:user:MahdiBot]] [[eo:user:MahdiBot]] [[es:user:MahdiBot]] [[et:user:MahdiBot]] [[eu:user:MahdiBot]] [[ext:user:MahdiBot]] [[ff:user:MahdiBot]] [[fiu-vro:user:MahdiBot]] [[fi:user:MahdiBot]] [[fj:user:MahdiBot]] [[fo:user:MahdiBot]] [[frp:user:MahdiBot]] [[frr:user:MahdiBot]] [[fr:user:MahdiBot]] [[fur:user:MahdiBot]] [[fy:user:MahdiBot]] [[gan:user:MahdiBot]] [[ga:user:MahdiBot]] [[gd:user:MahdiBot]] [[glk:user:MahdiBot]] [[gl:user:MahdiBot]] [[gn:user:MahdiBot]] [[got:user:MahdiBot]] [[gu:user:MahdiBot]] [[gv:user:MahdiBot]] [[hak:user:MahdiBot]] [[ha:user:MahdiBot]] [[haw:user:MahdiBot]] [[hif:user:MahdiBot]] [[hi:user:MahdiBot]] [[hsb:user:MahdiBot]] [[ht:user:MahdiBot]] [[hy:user:MahdiBot]] [[ia:user:MahdiBot]] [[id:user:MahdiBot]] [[ie:user:MahdiBot]] [[ig:user:MahdiBot]] [[ik:user:MahdiBot]] [[ilo:user:MahdiBot]] [[io:user:MahdiBot]] [[is:user:MahdiBot]] [[it:user:MahdiBot]] [[iu:user:MahdiBot]] [[ja:user:MahdiBot]] [[jbo:user:MahdiBot]] [[jv:user:MahdiBot]] [[kaa:user:MahdiBot]] [[kab:user:MahdiBot]] [[ka:user:MahdiBot]] [[kbd:user:MahdiBot]] [[kg:user:MahdiBot]] [[ki:user:MahdiBot]] [[kk:user:MahdiBot]] [[kl:user:MahdiBot]] [[km:user:MahdiBot]] [[kn:user:MahdiBot]] [[krc:user:MahdiBot]] [[ksh:user:MahdiBot]] [[ks:user:MahdiBot]] [[ku:user:MahdiBot]] [[kv:user:MahdiBot]] [[kw:user:MahdiBot]] [[ky:user:MahdiBot]] [[lad:user:MahdiBot]] [[la:user:MahdiBot]] [[lbe:user:MahdiBot]] [[lb:user:MahdiBot]] [[lg:user:MahdiBot]] [[lij:user:MahdiBot]] [[li:user:MahdiBot]] [[lmo:user:MahdiBot]] [[ln:user:MahdiBot]] [[lo:user:MahdiBot]] [[ltg:user:MahdiBot]] [[lt:user:MahdiBot]] [[lv:user:MahdiBot]] [[map-bms:user:MahdiBot]] [[mdf:user:MahdiBot]] [[mg:user:MahdiBot]] [[mhr:user:MahdiBot]] [[mi:user:MahdiBot]] [[mk:user:MahdiBot]] [[ml:user:MahdiBot]] [[mn:user:MahdiBot]] [[mrj:user:MahdiBot]] [[mr:user:MahdiBot]] [[ms:user:MahdiBot]] [[mt:user:MahdiBot]] [[mwl:user:MahdiBot]] [[myv:user:MahdiBot]] [[my:user:MahdiBot]] [[mzn:user:MahdiBot]] [[nah:user:MahdiBot]] [[nap:user:MahdiBot]] [[na:user:MahdiBot]] [[nds-nl:user:MahdiBot]] [[ne:user:MahdiBot]] [[new:user:MahdiBot]] [[nl:user:MahdiBot]] [[nn:user:MahdiBot]] [[nov:user:MahdiBot]] [[no:user:MahdiBot]] [[nrm:user:MahdiBot]] [[nv:user:MahdiBot]] [[ny:user:MahdiBot]] [[oc:user:MahdiBot]] [[om:user:MahdiBot]] [[or:user:MahdiBot]] [[os:user:MahdiBot]] [[pag:user:MahdiBot]] [[pam:user:MahdiBot]] [[pap:user:MahdiBot]] [[pa:user:MahdiBot]] [[pcd:user:MahdiBot]] [[pdc:user:MahdiBot]] [[pfl:user:MahdiBot]] [[pih:user:MahdiBot]] [[pi:user:MahdiBot]] [[pl:user:MahdiBot]] [[pms:user:MahdiBot]] [[pnb:user:MahdiBot]] [[pnt:user:MahdiBot]] [[ps:user:MahdiBot]] [[qu:user:MahdiBot]] [[rm:user:MahdiBot]] [[rmy:user:MahdiBot]] [[rn:user:MahdiBot]] [[roa-rup:user:MahdiBot]] [[roa-tara:user:MahdiBot]] [[ru:user:MahdiBot]] [[rw:user:MahdiBot]] [[sah:user:MahdiBot]] [[scn:user:MahdiBot]] [[sco:user:MahdiBot]] [[sc:user:MahdiBot]] [[sd:user:MahdiBot]] [[se:user:MahdiBot]] [[sg:user:MahdiBot]] [[sh:user:MahdiBot]] [[simple:user:MahdiBot]] [[si:user:MahdiBot]] [[sk:user:MahdiBot]] [[sl:user:MahdiBot]] [[sm:user:MahdiBot]] [[sn:user:MahdiBot]] [[so:user:MahdiBot]] [[sq:user:MahdiBot]] [[srn:user:MahdiBot]] [[sr:user:MahdiBot]] [[ss:user:MahdiBot]] [[stq:user:MahdiBot]] [[st:user:MahdiBot]] [[su:user:MahdiBot]] [[sv:user:MahdiBot]] [[sw:user:MahdiBot]] [[szl:user:MahdiBot]] [[ta:user:MahdiBot]] [[te:user:MahdiBot]] [[tg:user:MahdiBot]] [[th:user:MahdiBot]] [[ti:user:MahdiBot]] [[tk:user:MahdiBot]] [[tl:user:MahdiBot]] [[tn:user:MahdiBot]] [[to:user:MahdiBot]] [[tpi:user:MahdiBot]] [[tr:user:MahdiBot]] [[ts:user:MahdiBot]] [[tt:user:MahdiBot]] [[tum:user:MahdiBot]] [[tw:user:MahdiBot]] [[ty:user:MahdiBot]] [[udm:user:MahdiBot]] [[ug:user:MahdiBot]] [[uk:user:MahdiBot]] [[ur:user:MahdiBot]] [[uz:user:MahdiBot]] [[vec:user:MahdiBot]] [[ve:user:MahdiBot]] [[vls:user:MahdiBot]] [[vo:user:MahdiBot]] [[war:user:MahdiBot]] [[wa:user:MahdiBot]] [[wo:user:MahdiBot]] [[wuu:user:MahdiBot]] [[xal:user:MahdiBot]] [[xh:user:MahdiBot]] [[yi:user:MahdiBot]] [[za:user:MahdiBot]] [[zea:user:MahdiBot]] [[zh:user:MahdiBot]] [[zh-classical:user:MahdiBot]] [[zh-min-nan:user:MahdiBot]] [[zh-yue:user:MahdiBot]] [[zu:user:MahdiBot]] '''Owner''': [[:fa:user:Mahdiz|Mahdiz]] j28t32ijwfpbas6tk5tmozt2wjoedo6 Gebruikerbespreking:संतोष दहिवळ/common.js 3 2514 4628 2013-02-20T20:16:34Z 82.237.181.82 Nuwe bladsy geskep met 'ė' 4628 wikitext text/x-wiki ė i6retjt1wz0nnt4w7vpsqnso3l69ak5 Gebruikerbespreking:The Bible in Metre 3 2516 4631 2013-03-13T16:36:31Z The Bible in Metre 1160 gerbuiker 4631 wikitext text/x-wiki __NOTOC__ If you wish to leave a message, please do so [http://en.wikisource.org/wiki/User_talk:The_Bible_in_Metre here], thank you. exq3u3qcj2swqpxp9fkrp42b1ygjfn3 Gebruiker:The Bible in Metre 2 2517 4632 2013-03-13T16:36:42Z The Bible in Metre 1160 gebruiker 4632 wikitext text/x-wiki __NOTOC__ If you wish to leave a message, please do so [http://en.wikisource.org/wiki/User_talk:The_Bible_in_Metre here], thank you. exq3u3qcj2swqpxp9fkrp42b1ygjfn3 Gebruiker:MJ94/common.js 2 2518 4635 2013-03-24T16:24:41Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by MJ94]]) 4635 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:MJ94/global.js&action=raw&ctype=text/javascript'); h49gs4mgd3t5c9wyrikjug5zvkpn7kv Gebruiker:Vacation9/common.js 2 2519 4636 2013-03-24T17:32:53Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Vacation9]]) 4636 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Vacation9/global.js&action=raw&ctype=text/javascript'); d2r5k2culovici3hq4kxyskbldp19jp Gebruiker:MarcGarver/common.js 2 2522 7145 4639 2021-12-23T10:10:18Z Ternarius 2354 Ternarius het bladsy [[Gebruiker:QuiteUnusual/common.js]] na [[Gebruiker:MarcGarver/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/QuiteUnusual|QuiteUnusual]]" to "[[Special:CentralAuth/MarcGarver|MarcGarver]]" 4639 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:QuiteUnusual/global.js&action=raw&ctype=text/javascript'); ozkxsiaxnjtqzex00x2y77f845nf2wv Gebruiker:Soul Train/common.js 2 2523 4640 2013-03-25T00:53:34Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Soul Train]]) 4640 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Soul Train/global.js&action=raw&ctype=text/javascript'); 6qwcojg9yj8tlbkjmf64ogd88cnbepz Gebruiker:Razr Nation/common.js 2 2524 5189 4641 2015-12-30T19:04:28Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21/common.js]] na [[Gebruiker:Razr Nation/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5189 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Hahc21/global.js&action=raw&ctype=text/javascript'); bs42x31d4gl13hy71n4x1xvrisbvycp Gebruiker:VIGNERON 2 2525 4642 2013-04-06T12:07:20Z VIGNERON 1181 + IWL 4642 wikitext text/x-wiki [[fr:user:VIGNERON]] [[:fr:user:VIGNERON]] 4jfr7f94p5j0lw8xzjxm35lukv5rlc1 Gebruiker:RileyBot/Stop 2 2526 4648 4647 2013-04-16T01:13:46Z ~riley 993 disable 4648 wikitext text/x-wiki disable nxtahk3t41kbuldajcexl2qzue0v1og Gebruiker:Seti6908 2 2527 4650 2013-04-20T02:37:25Z Seti6908 1155 Nuwe bladsy geskep met '{{#babel:pl|de-1|en-1}} [[de:Benutzer:Seti6908]] [[en:User:Seti6908]] [[pl:Wikipedysta:Seti6908]]' 4650 wikitext text/x-wiki {{#babel:pl|de-1|en-1}} [[de:Benutzer:Seti6908]] [[en:User:Seti6908]] [[pl:Wikipedysta:Seti6908]] ons39ucvuccbcsa8qeptslu9toewa82 Gebruiker:S.M.Samee 2 2528 4653 4652 2013-04-28T17:50:56Z Hoo User Page Bot 827 Creating global user page, per request https://meta.wikimedia.org/w/index.php?diff=5240959&oldid=5239167 4653 wikitext text/x-wiki {{softredirect|w:en:User talk:S.M.Samee}} g7rqs6n50baydaqxems7vzo0y6ix12g Gebruiker:Razr Nation 2 2529 5185 4654 2015-12-30T19:01:23Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21]] na [[Gebruiker:Razr Nation]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5185 wikitext text/x-wiki <div style="position: relative; margin: 0 -1em; padding: 0; background-color: transparent; border: 1px none #ddd; height: 1%;"> <div style="position: relative; margin: 0 auto; background: #DED3CF; width: 950px; border: 1px solid #cccccc; height: 1%;"> <div style="position: relative; overflow: hidden; height:750px;"><!-- Height of the main image --> <div style="position: relative; overflow: hidden; margin: 0;">[[File:Nature at Caracas (27).jpg|1000px]]</div> </div> <div style="position: absolute; top: 0; width: 100%; height: 100%;"> <div style="position: absolute; left: 0.9em; top: 1em; z-index: 10; width: 250px; border: none; background-color:none;"> <!-- START LEFT USERBOXES --> <div style="opacity: 0.8; -moz-opacity: 0.8;"> <!-- END LEFT USERBOXES --> </div></div> <div style="position: absolute; right: 0.4em; top: 1em; z-index: 10; width: 250px; border: none; background-color:none;"> <!-- START RIGHT USERBOXES --> <div style="opacity: 0.8; -moz-opacity: 0.8;"> <!-- END RIGHT USERBOXES --> </div></div></div> </div> <br> {| style="font-family:Tahoma; background-color: #FFFFFF; border: 1px solid #CCCCCC; width:950px" cellpadding="15" align="center" | [[File:Razr Nation logo.png|center]] <center>| <span class="plainlinks">[[Special:Contributions/Hahc21|contribs]] · [[:luxo:Hahc21|cross-wiki]] · [http://en.wikichecker.com/user/?t=Hahc21 wikichecker] · [http://meta.wikimedia.org/wiki/Identification_noticeboard identified] · [{{fullurl:Special:Listusers|limit=1&username=Hahc21}} lu]</span> |</center> <center>| '''Me at''': [[:d:User:Hahc21|Wikidata]] · [[:n:es:Usuario:Hahc21|Spanish Wikinews]] · [[:en:User:Hahc21|English Wikipedia]] · [[:commons:User:Hahc21|Commons]] · [[:m:User:Hahc21|Meta]] |</center> |} sdqdwk0m4lgow9bnif51kxlxkf0pf1u Gebruiker:Pratyya Ghosh 2 2530 6534 4868 2020-05-02T20:53:14Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Pratyya Ghosh]]) 6534 wikitext text/x-wiki <!------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------- NOTE THIS PLEASE. BEFORE MAKING ANY KIND OF EDITS / CHANGES TO THIS PAGE PLEASE LET ME KNOW AT ANY OF THE LINKS GIVEN AT THIS PAGE. IF YOU TRANSLATE / WANT TO TRANSLATE THIS PAGE IN SOME OTHER / MAIN LANGUAGE OF THIS WIKIMEDIA PROJECT, LET ME KNOW, AND THEN GO AHEAD. I'LL REALLY APPRECIATE THAT. BUT PLEASE DON'T BREAK ANY CODE. THANKS TO YOU FOR READING AND FOLLOWING THE WORDS. -------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------> {{DISPLAYTITLE:<span style="font: bold 30px 'Cambria';">User:Pratyya Ghosh</span>}} <div style="font-family: Cambria"> <table style="width: 750px; background-color:#f9f9f9; border-color: black; margin-left: auto; margin-right: auto;" border="14"> <tr style="height: 300px;"> <td style="width: 521px; height: 144px; border-color: #f9f9f9;"> <strong> <!----------------------------------------- START PARA 1 ----------------------------------------------> <p style="text-align: justify; padding-left: 7px; padding-right: 7px"> <span style="color:#006400"><big><big>'''HELLO AND WELCOME!'''</big></big></span> <br /> <big><big>This is '''Pratyya Ghosh''' </big></big><small><small>(check [[:commons:File:Pratyya Ghosh pronunciation.ogg|<u>'''THIS'''</u>]] out for the pronunciation).</small></small> <br /> I am from [[w:en:Bangladesh|'''Bangladesh''']], so I am a native speaker of [[w:en:Bengali Language|'''Bangla''']]. I can also frequently communicate using '''English''', and I can speak and understand '''Hindi'''.<br /> <br /> <span style="color:#B22222">I am not effectively active in this Wikimedia Project. If I've made any edit here, that is most probably an automated one. I do <u>NOT</u> visit this site often/regularly. So I can <u>NOT</u> guarantee a swift and quick reply, OR in WORST CASE, a reply.</span><br /> <br /> However, I am mostly active in the projects which uses the languages I know. <br /> So, if you want to <u>CONTACT ME</u> or <u>TALK TO ME</u> or know more about me, then please use the Wikimedia Projects mentioned below.<br /> </p> <!------------------------------------------- END PARA 1 -----------------------------------------------> <!----------------------------------------- START PARA 2 ----------------------------------------------> <p style="text-align: left; padding-left: 7px;"> ❏ <span style="color:#228B22"><big>'''Wikimedia Projects where I am mostly <u>active</u>:'''</big></span> * '''[[w:en:English Wikipedia|English Wikipedia]] ([[w:en:Main Page|enwiki]]) : [[w:en:User:Pratyya Ghosh|User Page]] ([[w:en:User talk:Pratyya Ghosh|talk page]]) ([[w:en:Special:Contributions/Pratyya_Ghosh|contributions]]) (<span class="plainlinks">[https://xtools.wmflabs.org/ec/en.wikipedia.org/Pratyya_Ghosh user-stats]</span>)''' * '''[[w:en:Bengali Wikipedia|Bangla Wikipedia]] ([[w:bn:প্রধান পাতা|bnwiki]]) : &nbsp;[[w:bn:ব্যবহারকারী:Pratyya Ghosh|User Page]] ([[w:bn:ব্যবহারকারী আলাপ:Pratyya Ghosh|talk page]]) ([[w:bn:বিশেষ:অবদান/Pratyya_Ghosh|contributions]]) (<span class="plainlinks">[https://xtools.wmflabs.org/ec/bn.wikipedia.org/Pratyya_Ghosh user-stats]</span>)''' </p> <!------------------------------------------- END PARA 2 -----------------------------------------------> </strong> </td> </tr> </table> </div> <!------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------- END OF CODE -------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------> o22gone0vn0cnupb7is833hah5g5p4f Gebruikerbespreking:MarcGarver 3 2531 7370 7146 2024-02-08T13:21:59Z MarcGarver 1161 username change 7370 wikitext text/x-wiki #REDIRECT [[meta:User talk:MarcGarver]] g13dauus2v8qw0pomxt0nbw3kaioj3k Gebruiker:MarcGarver 2 2532 7149 4660 2021-12-23T10:11:19Z Ternarius 2354 Ternarius het bladsy [[Gebruiker:QuiteUnusual]] na [[Gebruiker:MarcGarver]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/QuiteUnusual|QuiteUnusual]]" to "[[Special:CentralAuth/MarcGarver|MarcGarver]]" 4660 wikitext text/x-wiki {{#babel:en|fr-2}} 69ccli5psavlrr25h3hxqms3o9zhwl2 Gebruikerbespreking:Pratyya Ghosh 3 2533 6535 4754 2020-05-02T21:58:23Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Pratyya Ghosh]]) 6535 wikitext text/x-wiki <!------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------- BEGIN -------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------> {{DISPLAYTITLE:<span style="font: bold 30px 'Cambria';">User talk:Pratyya Ghosh</span>}} <div style="font-family: Cambria"> <table style="width: 750px; background-color:#f9f9f9; border-color: black; margin-left: auto; margin-right: auto;" border="14"> <tr style="height: 300px;"> <td style="width: 521px; height: 144px; border-color: #f9f9f9; font-weight: bold;"> <!----------------------------------------- START PARA 1 ----------------------------------------------> <p style="text-align: justify; padding-left: 7px; padding-right: 7px"> <big><big><span style="color:#006400">'''HELLO AND WELCOME'''</span> to the talk page of '''Pratyya Ghosh'''</big></big> <small><small>([[:commons:File:Pratyya Ghosh pronunciation.ogg|<u>'''pronunciation'''</u>]])</small></small> <br /> Before placing any message here, I would ask you to TAKE A LOOK at my [[User:Pratyya Ghosh|<u>'''user page'''</u>]] on this wiki. <br /> If you have come here after looking at my user page, then once again I would like to mention the fact that, </p> <!------------------------------------------- END PARA 1 -----------------------------------------------> <!----------------------------------------- START PARA 2 ----------------------------------------------> <p style="text-align: justify; padding-left: 50px; padding-right: 110px"> <small> <span style="color:#B22222">I am not effectively active in this Wikimedia Project. If I've made any edit here, that is most probably an automated one. I do <u>NOT</u> visit this site often/regularly. So I can <u>NOT</u> guarantee a swift and quick reply, OR in WORST CASE, a reply.</span><br /> So, if you want to <u>CONTACT ME</u> or <u>TALK TO ME</u> or know more about me, then please use the Wikimedia Projects mentioned below.<br /> ⦿ '''[[w:en:English Wikipedia|English Wikipedia]] ([[w:en:Main Page|enwiki]]) : [[w:en:User:Pratyya Ghosh|User Page]] ([[w:en:User talk:Pratyya Ghosh|talk page]]) ([[w:en:Special:Contributions/Pratyya Ghosh|contributions]]) (<span class="plainlinks">[https://xtools.wmflabs.org/ec/en.wikipedia.org/Pratyya_Ghosh user-stats]</span>)'''<br /> ⦿ '''[[w:en:Bengali Wikipedia|Bangla Wikipedia]] ([[w:bn:প্রধান পাতা|bnwiki]]) : &nbsp;[[w:bn:ব্যবহারকারী:Pratyya Ghosh|User Page]] ([[w:bn:ব্যবহারকারী আলাপ:Pratyya Ghosh|talk page]]) ([[w:bn:বিশেষ:অবদান/Pratyya Ghosh|contributions]]) (<span class="plainlinks">[https://xtools.wmflabs.org/ec/bn.wikipedia.org/Pratyya_Ghosh user-stats]</span>)''' </small> </p> <!------------------------------------------- END PARA 2 -----------------------------------------------> <!----------------------------------------- START PARA 3 ----------------------------------------------> <p style="text-align: justify; padding-left: 7px; padding-right: 7px"> Yet if you want to place message here, then please FOLLOW THESE NOTES:<br /> ⚫ Do NOT [[w:en:Wikipedia:Vandalism|Vandalize]] this page. I WON'T be appreciating you for that.<br /> ⚫ Be on point. Please don't put some unnecessary message or bring up any irrelevant issues.<br /> ⚫ Use a language which I understand. (Otherwise, even if I see your message, I might not be able to reply.)<br /> ⚫ BE <u>CIVIL</u> and MAINTAIN <u>ETIQUETTE</u>.<br /> ⚫ Finally, you MUST sign your post with <nowiki>~~~~</nowiki><br /> </p> <!------------------------------------------- END PARA 3 -----------------------------------------------> </td> </tr> </table> <!------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------- START BELOW THIS PARA. DO NOT CHANGE ANYTHING ABOVE THE LINE. BEFORE PLACING ANY MESSAGE HERE, ONCE AGAIN, I AM NOT EFFECTIVELY ACTIVE IN THIS WIKIMEDIA PROJECT. IF I'VE MADE ANY EDIT HERE, THAT IS MOST PROBABLY AN AUTOMATED ONE. I DO NOT VISIT THIS SITE OFTEN/REGULARLY. SO I CAN NOT GUARANTEE A SWIFT AND QUICK REPLY, OR IN WORST CASE, A REPLY. -------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------> 9qtlaulm2q8nlzm95nj3cdbnjjsv70g Gebruiker:Notox 2 2534 4666 2013-06-01T13:49:10Z Notox 1245 intro 4666 wikitext text/x-wiki [[File:OSM Logo.svg|thumbnail|Open street map crossworking]] This account is to dedicated to coordination of crosswikiprojects. see: * https://wiki.openstreetmap.org/wiki/User:Notox * http://www.openstreetmap.org/user/notox * http://meta.wikimedia.org/wiki/User:Notox * http://commons.wikimedia.org/wiki/User:Notox * http://ar.wikipedia.org/wiki/مستخدم:Notox * http://ca.wikipedia.org/wiki/Usuari:Notox * http://da.wikipedia.org/wiki/Bruger:Notox * http://es.wikipedia.org/wiki/Usuario:Notox * http://fa.wikipedia.org/wiki/ویژه:مشارکت‌ها/Notox * http://he.wikipedia.org/wiki/משתמש:Notox * http://nl.wikipedia.org/wiki/Gebruiker:Notox * http://pt.wikipedia.org/wiki/Usuário(a):Notox * http://ro.wikipedia.org/wiki/Utilizator:Notox * http://simple.wikipedia.org/wiki/User:Notox * http://sv.wikipedia.org/wiki/Användare:Notox * http://uk.wikipedia.org/wiki/Користувач:Notox * http://vi.wikipedia.org/wiki/Thành_viên:Notox 6m1id5ngi813xjuzj46uodlzjjbs40k Gebruikerbespreking:Glaisher 3 2536 4668 2013-06-02T10:11:47Z Glaisher 1215 Nuwe bladsy geskep met '{{Softredirect|meta:User talk:Glaisher}}' 4668 wikitext text/x-wiki {{Softredirect|meta:User talk:Glaisher}} eiuuslwnz5g0m7os2wxvk4awqpamo92 Gebruiker:Lukas²³ 2 2538 4670 2013-06-02T23:27:50Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Lukas²³]]) 4670 wikitext text/x-wiki Hello! I'm Lukas. As a member of the [[m:Small Wiki Monitoring Team|Small Wiki Monitoring Team]], I was probably just here to fix or revert unhelpful edits. You can contact me [[m:User talk:Lukas²³|here (Meta-Wiki)]]. {{#babel:de-N|en-3|fr-1}} Regards, [[m:User:Lukas²³|Lukas²³]] m757r6e97b6jywxzfvlsai29gq6iumx Gebruiker:Moe Epsilon/Round corners 2 2539 4675 2013-06-21T13:27:48Z Moe Epsilon 156 + 4675 wikitext text/x-wiki {{User:Moe Epsilon/border-radius|1em}} {{User:Moe Epsilon/box-shadow|0.1em|0.1em|0.5em|rgba(0,0,0,0.75)}} dxfdaw5u6398n5x11aaowhal3294rd0 Gebruiker:Moe Epsilon/border-radius 2 2540 4676 2013-06-21T13:28:15Z Moe Epsilon 156 + 4676 wikitext text/x-wiki <includeonly>-moz-border-radius: {{{1|8px}}}; -webkit-border-radius: {{{1|8px}}}; border-radius: {{{1|8px}}};</includeonly><noinclude> 10of7hcnf71onksd186kycfembht4zf Gebruiker:Moe Epsilon/box-shadow 2 2541 4677 2013-06-21T13:28:39Z Moe Epsilon 156 + 4677 wikitext text/x-wiki <includeonly>-moz-box-shadow: {{{1|4px}}} {{{2|4px}}} {{{3|4px}}} {{{4|#CCC}}}; -webkit-box-shadow: {{{1|4px}}} {{{2|4px}}} {{{3|4px}}} {{{4|#CCC}}}; box-shadow: {{{1|4px}}} {{{2|4px}}} {{{3|4px}}} {{{4|#CCC}}};</includeonly><noinclude> ei6cswcq0g48ggcfdawwvt3bbngn9gi Gebruikerbespreking:Moe Epsilon/Header 3 2542 4680 2013-06-21T13:31:19Z Moe Epsilon 156 + 4680 wikitext text/x-wiki {{DISPLAYTITLE:<font face="Segoe Script"><span style="color:royalblue;">Gebruikerbespreking:Moe Epsilon</font></span>}} {| align=center style="border:5px solid #D0E7FF; {{User:Moe Epsilon/Round corners}}; background:#FFFFFF; -moz-border-radius:15px; padding:5px;" | width=775px valign=top | <div style="background-color: #FFFFFF; border: 1px solid #D0E7FF; padding-left:5px"><span style="font-family: Comic Sans MS"> '''Welcome to my talk page'''. Here are some tips to help you communicate with me: * Ideally, I would like to have any conversation continued on the page where it was started. If I have left a message on your talk page please do not reply here. I will have your talk page on watch and will note when you have replied. * Add or respond to an existing conversation under the existing heading. :*Indent your comment when replying by using an appropriate number of colons <tt>':'</tt>. :*Create a new heading if the original conversation is archived. * To initiate a new conversation on this page '''[{{fullurl:{{#rel2abs:{{{link|./}}}|{{{base|}}}}}|action=edit&section=new}} click on this link]'''. * You should sign your comments. You can do this automatically by typing four tildes (<nowiki>~~~~</nowiki>). </span></span></div> 5ckkxk4wthv2rjkkp5o605fsbk8zfve Gebruiker:FrigidNinja/common.js 2 2543 4684 2013-07-02T02:51:52Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by FrigidNinja]]) 4684 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:FrigidNinja/global.js&action=raw&ctype=text/javascript'); 1ad7mvbfckmxgbqjjd3woeefbtvwdbl Gebruiker:Knopfkind/common.js 2 2545 4687 2013-07-03T03:03:43Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Knopfkind]]) 4687 javascript text/javascript mw.loader.load("//de.wikipedia.org/w/index.php?title=Benutzer:Knopfkind/global.js&action=raw&ctype=text/javascript"); mxlwb5jbyijlz06up8aadcbgx7hebyi Gebruiker:TCN7JM 2 2546 4740 4689 2013-10-13T16:38:04Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by TCN7JM]]) 4740 wikitext text/x-wiki {{DISPLAYTITLE:<font face="Tahoma">User:</font><font color="blue" face="Tahoma">T</font><font color="red" face="Tahoma">C</font><font color="gray" face="Tahoma">N7</font><font face="Tahoma">JM</font>}} <center><font face="Tahoma">[[w:en:User:TCN7JM|English Wikipedia]] &mdash; [[d:User:TCN7JM|Wikidata]] &mdash; [[w:simple:User:TCN7JM|Simple English Wikipedia]] &mdash; [[m:User talk:TCN7JM|Contact me]]</font></center> [[File:TCN7JM Global Userpage.png|center|middle]] 4v20vrzaoqwfb827ef0df1x3hxhxdgv Gebruiker:Akhilan 2 2547 4690 2013-07-19T14:10:10Z Akhilan 1026 Nuwe bladsy geskep met '<div style="min-height: 57px; border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 50%; margin: 0 auto 1em auto; padding: .2em; text-align: justify;"> <div style=...' 4690 wikitext text/x-wiki <div style="min-height: 57px; border: 1px solid #aaaaaa; background-color: #f9f9f9; width: 50%; margin: 0 auto 1em auto; padding: .2em; text-align: justify;"> <div style="float: left">[[Image:Wiki.png|50px| ]]</div> <div style="margin-left: 60px">'''Interwiki redirect''' <br> This page can be found at [[w:User:Akhilan|Akhilan]] or [[w:ml:User:Akhilan|അഖിലൻ</span>]] .</div> </div> 3mdhcacij2ldjzg7ps8x4e1cuq94dtw Gebruiker:Limotecariu 2 2548 5574 5280 2018-03-25T20:13:30Z Limotecariu 621 5574 wikitext text/x-wiki {{#babel:es|ast-4|fr-3|it-3|ro-3|pt-2|en-2|ca-2|gl-1|he-1|af-0}} 03qydl4vsjx22gxtvwhw4po1u8iuggo Gebruiker:Kolega2357 2 2550 4862 4695 2014-06-10T11:44:45Z JurgenNL 1201 Het [[Gebruiker:Kolega2357]] beskerm: User request ([[m:GS|global sysop]] action) ([Wysig=Laat slegs outomaties bevestigde gebruikers toe] (verval nie) [Skuif=Laat slegs outomaties bevestigde gebruikers toe] (verval nie)) 4862 wikitext text/x-wiki <div align="center" class="usermessage">[[File:Internet-group-chat.svg|left|25px]] '''<span class="plainlinks">Send me a new message [https://meta.wikimedia.org/w/index.php?title=User_talk:Kolega2357&action=edit&section=new here]</div> 66zgvzht0wewtwfteswq66hkbdv574w Gebruiker:Nirakka/common.js 2 2551 4696 2013-08-16T19:06:23Z Nirakka 1271 global JS from meta 4696 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Nirakka/global.js&action=raw&ctype=text/javascript'); ivy7jznevtbkfvg3gj0p9ywoh3uph4k Gebruiker:Nirakka 2 2552 4698 2013-08-31T22:47:22Z Nirakka 1271 creating user page (script edit) 4698 wikitext text/x-wiki {{#babel:de-N|en-3|af-0}} I help [[meta:Small Wiki Monitoring Team|monitoring small wikis]]. For further information see [[meta:User:Nirakka]]. [[File:Wikipedia h2g2.jpg|400px|center]] gwhkqb62rntvx9ommzssiy60ec23tfp Gebruiker:Romaine 2 2553 4708 2013-09-14T10:40:17Z Romaine 194 Nuwe bladsy geskep met '* '''(nl)''': Deze gebruikerspagina is van een gebruiker die het meest actief is op de Nederlandstalige Wikipedia. <br> * '''(en)''': This userpage is from a frequent wik...' 4708 wikitext text/x-wiki * '''(nl)''': Deze gebruikerspagina is van een gebruiker die het meest actief is op de Nederlandstalige Wikipedia. <br> * '''(en)''': This userpage is from a frequent wikipedian from the Dutch Wikipedia. <br> * '''(de)''': Diese Benutzerseite ist von einem Benutzer von der Niederländischen Wikipedia.<br> <br /> :::[[File:2rightarrow.png|20px]] My homewiki is located at: [[w:nl:Gebruiker:Romaine]]<br> <br /> [[File:2rightarrow.png|20px]] If you want to contact me, please write a message on my nl-Wikipedia [http://nl.wikipedia.org/w/index.php?title=Overleg_gebruiker:Romaine&action=edit&section=new talk-page]. <small> :* Please mention that it takes some time before messages on my talkpage of this project are seen. </small> ----<br> d5v0lqlc3sm8otz5fvkl3zv3fpu0wyi Gebruikerbespreking:Romaine 3 2554 4709 2013-09-14T10:40:19Z Romaine 194 Nuwe bladsy geskep met '* '''(nl)''': Deze gebruikerspagina is van een gebruiker die het meest actief is op de Nederlandstalige Wikipedia. <br> * '''(en)''': This userpage is from a frequent wik...' 4709 wikitext text/x-wiki * '''(nl)''': Deze gebruikerspagina is van een gebruiker die het meest actief is op de Nederlandstalige Wikipedia. <br> * '''(en)''': This userpage is from a frequent wikipedian from the Dutch Wikipedia. <br> * '''(de)''': Diese Benutzerseite ist von einem Benutzer von der Niederländischen Wikipedia.<br> <br /> :::[[File:2rightarrow.png|20px]] My homewiki is located at: [[w:nl:Gebruiker:Romaine]]<br> <br /> [[File:2rightarrow.png|20px]] If you want to contact me, please write a message on my nl-Wikipedia [http://nl.wikipedia.org/w/index.php?title=Overleg_gebruiker:Romaine&action=edit&section=new talk-page]. <small> :* Please mention that it takes some time before messages on my talkpage of this project are seen. </small> ----<br> d5v0lqlc3sm8otz5fvkl3zv3fpu0wyi Gebruiker:Knopfkind/common.css 2 2556 4711 2013-09-15T21:36:00Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by Knopfkind]]) 4711 css text/css @import "//de.wikipedia.org/w/index.php?title=Benutzer:Knopfkind/global.css&action=raw&ctype=text/css"; cecddlyfgkfe7ic5sztx0q3nzchdsal Gebruiker:Razr Nation/common.css 2 2557 5187 4712 2015-12-30T19:03:00Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21/common.css]] na [[Gebruiker:Razr Nation/common.css]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5187 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:Hahc21/global.css&action=raw&ctype=text/css"; 7g4x6knmp3vyc37fzpnizhtomrecyso Gebruiker:Bellayet/common.js 2 2558 4713 2013-09-18T00:21:14Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Bellayet]]) 4713 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Bellayet/global.js&action=raw&ctype=text/javascript'); b52e6o2o28jg360opd5q4leedft135q Gebruiker:*Youngjin/common.js 2 2559 5270 4714 2017-12-06T21:02:55Z -revi 1254 -revi het bladsy [[Gebruiker:분당선M/common.js]] na [[Gebruiker:*Youngjin/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5270 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:%EB%B6%84%EB%8B%B9%EC%84%A0M/global.js&action=raw&ctype=text/javascript'); mbvzo0n6smqy1qq9skech5273xqjsm9 Gebruiker:LlamaAl/common.css 2 2564 4720 2013-09-19T03:18:09Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by LlamaAl]]) 4720 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:LlamaAl/global.css&action=raw&ctype=text/css"; keqd1vd77jud9evny17wbnai8awv1wh Gebruiker:LlamaAl 2 2565 4721 2013-09-19T03:46:33Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by LlamaAl]]) 4721 wikitext text/x-wiki __NOINDEX__ [[:m:user:LlamaAl]] 5k6cylbo9luu5ncjnu4ax2hqsbnvydt Gebruikerbespreking:LlamaAl 3 2566 4722 2013-09-19T04:08:59Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by LlamaAl]]) 4722 wikitext text/x-wiki __NOINDEX__ [[:m:user talk:LlamaAl]] oub4g2jl4r1fb2czujsn6wgu83g97l3 Gebruiker:WorldTraveller101 2 2567 4747 4723 2013-10-19T01:36:12Z Sportsguy17 1289 4747 wikitext text/x-wiki [[User:Sportsguy17|!]] 5weck8k92u5a300gija2zimg591b8ow Gebruikerbespreking:Wim b 3 2569 4776 4725 2013-11-20T23:36:26Z Wim b 1175 Editing global userpage 4776 wikitext text/x-wiki <div class="mw-content-ltr"> {{#babel:it|en-2|af-0}} :'''Talk''': my user talk on [[:m:it:wikt:User talk:Wim b|it.wikt]] :'''Info''': my user page on [[m:User:Wim b|Meta]] '''You can contact me also''' : * '''[[freenode:#wiktionary-it|#wiktionary-it]]''' * '''[[freenode:#wikipedia-it|#wikipedia-it]]''' * '''[[freenode:#wikbooks-it|#wikibooks-it]]''' * '''[[freenode:#wikivoyage-it|#wikivoyage-it]]''' * '''[[freenode:#wikimedia-admin|#wikimedia-admin]]''' * '''[[freenode:#wikimedia-gs|#wikimedia-gs]]''' </div> i7yiglvpcw6c1wh1ce1rneqc8anz1ik Gebruiker:Spacebirdy/common.css 2 2574 4730 2013-09-26T01:39:19Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by Spacebirdy]]) 4730 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:Spacebirdy/altækt.css&action=raw&ctype=text/css"; bqvpi9d4fil15fheszanjeyelf7804e Gebruiker:Spacebirdy/common.js 2 2575 6786 4731 2021-01-31T11:28:48Z Ladsgroup 1827 Maintenance: Replacing importScriptURI with mw.loader.load ([[phab:T95964]]) 6786 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Spacebirdy/altækt.js&action=raw&ctype=text/javascript'); km9s3o2cm5a2pnznrsp9bowpmbklnry Gebruiker:Sergio Andres Segovia/common.js 2 2577 4733 2013-09-28T19:17:43Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Sergio Andres Segovia]]) 4733 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Sergio Andres Segovia/global.js&action=raw&ctype=text/javascript'); kw7fnwvspulwu42vm2yj6n3qot7g4tk Gebruiker:Behemot leviatan/common.js 2 2578 4734 2013-09-28T19:40:42Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Behemot leviatan]]) 4734 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Behemot leviatan/global.js&action=raw&ctype=text/javascript'); dvsds5g4drwbhfmo1jvecbjsjdzug3v Gebruiker:-revi 2 2580 5106 4909 2015-08-01T21:44:23Z Pathoschild 29 global user pages ([[m:Synchbot|requested by -revi]]) 5106 wikitext text/x-wiki __NOINDEX__ <div class="mw-content-ltr" lang="en" dir="ltr"> {{#babel:ko|en-3|af-0}} [[File:Revi wikimedia image.jpg|thumb|center|middle|If you are here to talk about CommonsDelinker removing a deleted image, please [[:c:User talk:-revi|go here]].]] Hello! I am [[:m:User:-revi|Revi]]. I edit to [[m:SWMT|revert vandals]], do Wikidata stuff (I am a Wikidata Admin! <small>([{{fullurl:wikidata:Special:ListUsers/-revi|limit=1}} Verify])</small>), or do [[:c:COM:FR|Commons Filemoving stuff]] (I am Commons Admin too! <small>([{{fullurl:c:Special:ListUsers/-revi|limit=1}} Verify])</small>). Come to [[:m:User:-revi|my Meta userpage]] or [[:c:User:-revi|my Commons userpage]] for more information. Thank you. ---- This is not a [[mw:Extension:GlobalUserPage|GlobalUserPage]] provided userpage. It's maintained per-wiki basis and I am not willing to change it. leee2jpk56zb6p4rz24wulreeyijvib Gebruikerbespreking:-revi 3 2581 4910 4901 2014-11-02T03:10:21Z Pathoschild 29 global user pages ([[m:Synchbot|requested by -revi]]) 4910 wikitext text/x-wiki __NOINDEX__<div class="mw-content-ltr" lang="en" dir="ltr">[[File:Revi logo (pink).png|thumb|center|<span style="color:red">PLEASE DO NOT LEAVE MESSAGE HERE!</span>]] ''' <span style="color:red">Before blocking my account: if you're blocking me for edits with summaries containing </span>''(Script)''<span style="color:red">, just tell me to slow down at [[:c:User talk:-revi]] instead. Those are automated script edits for Commons' filemove system.</span> Please leave your message at one of the following sites:<br /> [[File:Wikidata-logo-en.svg|45px|link=d:User talk:-revi]] [[d:User talk:-revi]] for Wikidata/interwikilinks stuff (I'm one of the {{int:Group-sysop}} there);<br /> [[File:Commons-logo.svg|45px|link=commons:User talk:-revi]] [[commons:User talk:-revi]] for renaming stuff or [[User:CommonsDelinker|CommonsDelinker]] actions (I'm one of the {{int:Group-sysop}} there);<br /> [[File:Wikimedia Community Logo optimized.svg|45px|link=m:User talk:-revi]] [[meta:User talk:-revi]] for other stuff (like user right notifications or revert messages).</div> lwjsr976jdsq551jmw5zumkbtvudhn1 Gebruiker:*Youngjin/common.css 2 2583 5268 4741 2017-12-06T21:02:54Z -revi 1254 -revi het bladsy [[Gebruiker:분당선M/common.css]] na [[Gebruiker:*Youngjin/common.css]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5268 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:%EB%B6%84%EB%8B%B9%EC%84%A0M/global.css&action=raw&ctype=text/css"; gt41tyc1mmomd9lj9qv6vtr76ycszo0 Gebruiker:Galahad/common.js 2 2586 5575 5181 2018-04-04T19:21:43Z علاء 1834 علاء het bladsy [[Gebruiker:White Master/common.js]] na [[Gebruiker:Galahad/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/White Master|White Master]]" to "[[Special:CentralAuth/Galahad|Galahad]]" 5575 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:White Master King/global.js&action=raw&ctype=text/javascript'); dgab902j4rc9x4lh5nvneik9hap840j Gebruiker:Sportsguy17 2 2587 4748 2013-10-19T01:36:43Z Sportsguy17 1289 Nuwe bladsy geskep met '{{#babel:en|es-4|nl-3|de-2|fr-1|it-1|af-1}}' 4748 wikitext text/x-wiki {{#babel:en|es-4|nl-3|de-2|fr-1|it-1|af-1}} n42erfrjfe9g65p98eisp38i736rstn Gebruiker:Ajraddatz 2 2588 4749 2013-10-19T02:37:47Z Ajraddatz 884 + 4749 wikitext text/x-wiki [[m:User:Ajraddatz]] 5hbxr3mct1ew0w5ohskiasbc73ah7cx Gebruiker:William915 2 2591 4760 2013-10-28T06:04:20Z William915 1283 Editing global userpage 4760 wikitext text/x-wiki __NOINDEX__ {{softredirect|w:en:User:William915}} {{#babel:zh|yue|en-3|af-0}} 9v5ccc58jvi0uynaz8ryq9tbmx0fqxf Gebruiker:Renamed user 9thz5duyuxms 2 2592 7225 5276 2023-03-11T10:32:26Z Taketa 1539 Taketa het bladsy [[Gebruiker:KernelFreeze]] na [[Gebruiker:Renamed user 9thz5duyuxms]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/KernelFreeze|KernelFreeze]]" to "[[Special:CentralAuth/Renamed user 9thz5duyuxms|Renamed user 9thz5duyuxms]]" 5276 wikitext text/x-wiki {{#babel:es-N|en-3|fr-1|}} {{#switch: {{CONTENTLANG}} | es = <div class="mw-content-ltr" lang="es" dir="ltr">Hola. Yo no edito mucho aquí, pero soy un miembro de [[m:Special:MyLanguage/Small Wiki Monitoring Team|el Small Wiki Monitoring Team]]. Tu puedes encontrarme en Meta o en Wikipedia en idioma español: [[m:User:Miguel2706]], [[m:es:User:Miguel2706]]. </div> |<div class="mw-content-ltr" lang="en" dir="ltr">Hello. I do not edit here much, but I am a member of [[m:Special:MyLanguage/Small Wiki Monitoring Team|the Small Wiki Monitoring Team]]. You can find me on Meta or Wikipedia in spanish language: [[m:User:Miguel2706]], [[m:es:User:Miguel2706]]. </div> }} [[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Miguel2706|Meta:{{ns:3}}:Miguel2706]] l3tno7zc02yw4ouhjtw497l8zfc7zth Gebruiker:Renamed user 9thz5duyuxms/common.js 2 2593 7224 5278 2023-03-11T10:32:26Z Taketa 1539 Taketa het bladsy [[Gebruiker:KernelFreeze/common.js]] na [[Gebruiker:Renamed user 9thz5duyuxms/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/KernelFreeze|KernelFreeze]]" to "[[Special:CentralAuth/Renamed user 9thz5duyuxms|Renamed user 9thz5duyuxms]]" 5278 javascript text/javascript // Created using [[m:User:PiRSquared17/Global Userpage]] (feel free to remove this line) mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Miguel2706/global.js&action=raw&ctype=text/javascript'); mt87reyatdkpnh0iayjh58yfkjvfwj1 Boekrak:Geskiedenis 0 2594 5212 5211 2016-06-19T23:32:57Z Tropicalkitty 1589 restored opening edit (not sure what to do here...) 5212 wikitext text/x-wiki ‘n KULTUUR-HISTORIESE AGTERGROND VAN DIE VEEBOER GEDURENDE DIE AGTIENDE en NEGENTIENDE EEU AAN DIE KAAP 1. DIE KERKLIK-GODSDIENSTIGE LEWE 1.1 DIE EREDIENS Al het die kerkorde van Dort, behalwe die hoofdiens Sondagmôres, ook ‘n tweede of namiddagdiens voorgeskrywe, is daar gedurende die 18de eeu in die plattelandse gemeentes meestal net een diens – Sondagmôres – waargeneem. Eers aan die begin van die 19de eeu het namiddagdienste op die platteland meer gebruiklik geword, veral gedurende die wintermaande. Eers heelwat later is hierdie namiddagdienste op die platteland vervang deur die huidige aandienste. 1) Die erediens kan tereg die spil genoem word waarom die kerklike lewe draai. Alhoewel die erediens na sy inhoud sy hoofelemente, vroeër ongeveer dieselfde was as vandag, het die orde destyds heelwat anders as vandag verloop. Kort ná die eerste gelui het die eerste kerkganger binnegekom en plaasgeneem, mans en vrouens apart – familiebanke het eers later gekom – die vrouens het op stoele heel voor in die skip van die kerk gesit en die mans op banke agter hulle. Kort ná die tweede gelui het “mynheer de Voorleser” binnegekom en op die sg. “Voorleserstoel” links van die kansel gaan sit. Na ‘n paar oomblikke van stilte staan hy op, neem stelling in agter die sg. voorlesersknaap voor die kansel en doen die huweliks-en ander aankondigins, vervolgens neem hy die Skriflesing waar en wel uit die hooftuk waaruit die dominee weldra 1. Smit A P (ds) Gedenkboek van die Nederduitse Gereformeerde Gemeente Swartveld (1745-1945) p.101 sy teks vir sy preek sou neem (vandaar sy naam – Voorleser). Teen die tyd dat hy die “kapittel” deurgeworstel het, gaan die derde gelui en nou eers begin die eintlike erediens, wanneer die Voorleser die lofpsalm opgee en as “voorsinger” ook die gemeente lei. Orrels en veral pyporrels is eers later in eredienste gebruik. 1) Die Predikant het toe reeds ‘n vaste ampsdrag gehad. ‘n Swart rok met groot knope en breë omslae en pante, kort broek, lang sykouse en skoene met silwer gespes. Buite die kerk het dominee ‘n ronde, later driehoekige hoed, die sg. Steek gedra. Eers teen die einde van die 18de eeu het predikante ‘n mantel (voorloper van die toga) en bef begin dra. Die toga maak eers verskyning in die laaste helfte van die 19de eeu. 2) DIE LITURGIE Onder die sing van die lofpsalm kom die predikant, vergesel van die kerkraadslede die kerk binne en bestyg die preekgestoelte. Na die gebruiklike votum en seëngroet deur die predikant volg die lees van die Wet en die Twaalf Artikels of Geloofbelydenis. Dit is ook vroeër deur die Voorleser gedoen. In dié tyd is daar nie ná die Geloofbelydenis gesing nie. Die besondere plek wat die Voorleser sover ingeneem het, is eers later deur die predikant oorgeneem. Die predikant lewer eers sy sg. “voorafspraak”, ‘n lang inleiding tot sy preek, met sy teksverdeling of hoofgedagtes. Dit word opgevolg deur die sing van ‘n psalm. Die gesange is eers in 1814 ingevoer. Terwyl die diaken die liefdegawes “voor Kerk en Armen” opneem – in swart fluweelsakkies wat aan die punt van 1. Smit, A.P. Ongepubliseerde lesing – Die kerklike Gebruike aan die Kaap in die ou dae (1967) 2. Smit-lesing. lang stoke vasgemaak is. Aan die fluweelsakkies was ‘n sierlike kwassie of meer dikwels ‘n silwerklokkie wat klaarblyklik bedoel was om diegene wat intussen onder die lang “voorafspraak” begin insluimer het, weer wakker te maak! Na die kollekte volg die gewone kanselgebed terwyl aan die einde daarvan weer ‘n psalm gesing word. Daarna volg die preek wat ongeveer een en ‘n half tot twee uur geduur het. Die diens is dan afgesluit met ‘n nagebed, slotsang en seënbede. Die geskiedskrywer Theal het die indruk gekry dat hierdie 18de eeu eredienste maar baie koud en lewensloos moes gewees het en nie juis daarop bereken was om geestelike vuur en ywer by die kerkgangers op te wek nie.1) Dit was die eeu van die rasionalisme en koudheid op godsdienstige gebied. Die “deftige en doodsche preekwyze” van die meeste van die destydse predikante het dit ongetwyfeld in die hand gewerk. Behalwe dat die predikasies baie lank was, was die teksverdelings veelal te ingewikkeld en die voordrag te “droog” om in die smaak te val, veral van die jongmense, wat tóé reeds na meer prakties-evangeliese sielevoedsel gesmag het. Aan die begin van die 19de eeu, met die deurwerking van die “evangeliese” gees het ‘n gestadige verbetering in die preekstyl gekom. Hiertoe het manne soos ds. M.C. Vos, dr. H.R. van Lier en ander met hul prakties-evangeliese boodskappe ongetwyfeld baie bygedra. 2) Behalwe met nabetragingsdienste wat gedurende Nagmaalnaweke gehou is, is namiddagdienste eers later ingestel. By dié geleentheid het die predikant uit die kategismus gepreek en die 1. Vgl. Theal G.McC. History of South Africa III bl. 309 by Smit 2. Swartland bl. 103 Vgl. Smit Swarland bl. 104. jongmense en kinders moes dan die gebruiklike antwoorde op die kategismusvrae gee. Aanddienste het eers heelwat later gevolg en bidure eers in die 19de eeu. Die Doop- en Nagmaal-sakramente is deurgans aan die einde van die diens bedien. 1) DIE KERKSANG Nie alleen die onaantreklike preektrant nie, maar ook die kerksang van die agtiende en vroeg-negentiende eeue het daartoe bygedra dat die eredienste dikwels sonder geestelike besieling was. Die sang was in die reël baie stadig en temerig en van owerheidsweë moes die kerk selfs aangemaan word om “wat spoediger” te sing! Dwarsdeur die 18de eeu is daar natuurlik net psalms gesing en wel volgens die beryming van Petrus Dathenus. Hierdie beryming, met sy platheid van taal en onbeholpenheid van vorm, het nie juis bevredigende kerksang in die hand gewerk nie. In 1775 is hierdie sogenaamde “kreupele beryming” van Dathenus vervang deur die beter en meer moderne “Nuwe Rympsalms”, wat die kerksang ‘n stoot vorentoe gegee het. Tot die jaar 1814 is uitsluitend psalms in ons kerk gesing. In daardie jaar word die sogenaamde Evangliese Gesange - in 1806 reeds in Holland in gebruik geneem – vir die eerste maal in ons land ingevoer en wel deur die stadskerkraad, om kort daarna deur ander plattelandse gemeentes gevolg te word. Dit het ons kerksang verder verryk en verbeter. Die gemeentlede het destyds deurgans sittende gesing. Kore was tot in die twintigerjare van die 19de eeu ‘n onbekende iets. 2) 1. Smit-lesing 2. Vgl. Smit. Swartland. bl. 104. Kerkorrels en kerkkore was in dié tydperk onbekend. Eers 80 jaar ná Van Riebeeck kry Kaapstad sy eerste orrel (1737) en teen die einde van die 18de eeu kry Paarl sy orrel (1791) en Stellenbosch eers in 1801; Malmesbury eers in 1853; Durbanville in 1860. Die Voorleser, d.w.s. as hy kon sing, moes dus maar as voorsinger optree. 1) DIE VOORLESER Dit is vreemd dat die voorleser, en nie die predikant nie, die Skriflesing waargeneem het en veral dat dit gedoen is voordat die predikant en die kerkraadslede teenwoordig was en die erediens begin het. Baie kerkgangers het dan ook later gewag totdat die temerige skriflesing deur die voorleser verby was voordat hul die kerk binnegekom het. Dit was baie onstigtelik. Baie stemme het dan ook teen die funksie van die voorleser opgegaan. Die voorlesertradisie was egter so diep gewortel dat die sinode eers in 1857 aanbeveel het dat die predikant en kerkraadslede teenwoordig moet wees wanneer die Skriflesing geskied, hetsy deur die voorleser of die predikant. Maar kerkrade was traag om hierin ‘n verandering aan te bring. In ‘n gemeente soos Swartland het ds. Moorrees eers in 1873 “tot meerdere stigting” die skriflesing self waargeneem. Dit het die einde van die voorleserskap in die Ned. Geref. Kerk beteken. Die voorleser moes hul streng by die voorgeskrewe formule en die preekboek van geordende predikante hou. Onder geen omstandighede mag ‘n vrye voordrag of eie preek gelewer word nie. Toe Wijlandt dit in 1654 waag om “eenige lessen buyten syn boeck” vry voor te dra, het hy in die warm water beland. Die owerheid het hom vanuit Batavia sterk oor die kole gehaal en hom vermaan om hom binne die limiete van die “vocatie” te hou en nie verder sy sekel in ‘n ander se oesland te slaan nie! 1. Smit-lesing Toe Van Riebeeck hom daaroor betig het, het hy voorgegee dat sy oë hom in die steek laat en hy gevolglik genoodsaak was om die voorgeskrewe preke stuk-stuk uit sy hoof te leer “om in’t lessen te min te haperen”. By afwesigheid van die predikant moes die voorleser die erediens lei en ‘n preek voorlees, sonder aanstoot of ergenis, vaardig en Godbetamelik. Baie interessante staaltjies word vertel oor eiewillige voorlesers wat by die afwesigheid van die dominee dit gewaag het om sy eie Skrifgedeelte te kies, of selfs sy eie preek voor te dra. 1) RANGORDE IN DIE KERK Veral in die 17de, 18de en selfs vroeë 19de eeu was die mense, veral vrouens, baie gesteld daarop dat hul sitplek in die kerk in ooreenstemming moet wees met hul rang of status in die samelewing. Die owerheid, onder wie die kerk toe nog gestaan het, het dan ook van tyd tot tyd “Ranglyste” uitgevaadig – en bewaar die arme koster as hy in die rangskikking van die sitplekke die vrouens van die vooraanstaandes die minste van hierdie “protocol” sou afwyk! Wanneer die goewerneur die kerk binnekom, moes almal opstaan en met ‘n diepe buiging eerbied betoon. Toe arme ouderling Jan Rotterdam, wat buitendien sy mes in gehad het vir die gehate W.A. van der Stel, in 1707 op ‘n goeie dag in die Groote Kerk, Kaapstad, nie vir die goewerneur wou opstaan nie, is hy voor die Politieke Raad gedaag en uiteindelik verban. Aan weerskante van die kansel het voor die dienende kerksraadslede ook die hoë regeringsamptenare soos die landdros en heemrade, die ereplekke ingeneem. Die sewe Kwartobybels wat De 1. Smit-lesing. Mist in 1819 geskenk het was vir vier kerkraadslede en die landdros Cuyler en sy twee heemrade in die voorste banke weerskante van die kansel. Net agter hul het rustende kerksraadlede, oud-heemrade, ens. in rangorde plekke ingeneem. Die stoele van die vroue voor in die skip van die kerk moes weer na die rang van hul mans gerangskik word. Byvoorbeeld die voorste ry: die predikantsvrou, met die gades van dienende kerkraadslede en hoê regeringsamptenare naas haar; daarna volg die eggenotes van rustende kerkraadslede e.a. van die oudste en aansienlikste vroue tot “onstigtelike tonele” binne-in Gods huis. Meermale het ‘n gegriefde suster haar op die landdros en selfs die Politieke Raad beroep. Kerkrade het ‘n sug van verligting geslaak toe “het volkomen toeverzickt over de zitplaatsen der vrouwen” van hul skouers op dié van die landdros geplaas is. Eers in 1829 het die Sinode van die Ned. Geref. Kerk besluit dat die eggenotes van rustende kerkraadslede in die vervolg “gene ranplaasen meer zullen hebben”. Maar so rangbewus was ons mense in daardie jare dat die rangorde in die kerk ‘n besonder stadige dood gesterwe het. Dit was eers in 1860 dat die gemeente Swartland bv. afgesien het van aparte vrouesitplekke in die kerk. 1) 1.2 NAGMAAL DIE VOORBEREIDING VIR NAGMAAL Ons vaders het besonder baie van die Nagmaalsfees gemaak. In die eerste jare in en rondom Kaapstad, voordat die gemeentes 1. Smit-lesing. baie uitgestrek was, het die dominee, vergesel van ‘n ouderling, sowat 14 dae tevore by die huise omgegaan en die kerkraadslede persoonlik uitgenooi na die Nagmaal. Daar was selfs ‘n tyd toe kerkraadslede kort voor die Nagmaal byeengekom gekom “op malkonders gedrag acht te gaan”. Op die ry af moes elke broeder uitgaan en buite wag terwyl sy medebroeders hom bespreek het. 1) NAGMAALNAWEKE Namate die kerk binnelands uitgebrei en die gemeentes meer uitgestrek geraak het, moes ons mense oor baie ver afstande met die ossewaens reis vir die kwartaallikse Nagmaal op die dorp – 15 en meer uur te perd. Van die Donderdag af was die kerkplein met die wit watente oortrek. Vrydag is inkopies by die winkels gedoen en Saterdagoggend was basaar. Die namiddag is die voorbereidende diens gehou. Maandag of self Dinsdag is die lang terugreis aanvaar. 2) DIE NAGMAALTAFEL Hier en daar was daar arm gemeentes wat hulle aan die begin tevrede moes stel met “avondmaalgereedskap van aarde en luttel (min) waardy”. In sommige gevalle het hulle hul selfs van ”bierglazen en spoelkom” bedien. Die gemeentes het egter waar moontlik, ‘n silwer Nagmaalservies aangeskaf. So bv. het landdros Cuyler al in 1817, deur Ds. Mol van Uitenhage, uit Kaapstad ‘n silwer Nagmaalservies en doopbekken bestel. Dit is uit egte Kaapse silwer vervaardig deur die beroemde Kaapse silwersmid, Johannes Combrink, en is vir baie jare gebruik totdat dit as kosbare kleinode aan gebruik onttrek is en vandag veilig bewaar word. 1. Smit-lesing. 2. Smit-lesing. Dit was vir baie jare die gebruik dat die Nagmaalgangers – eers die mans en daarna die vroue – op uitnodiging van die bedienaar groepsgewyse uit hul banke opgestaan en by die Nagmaalstafel voor die kansel aangesit het. Sodra hul klaar bedien is en ‘n “tafeltoespraak” aangehoor het, het hul teruggegaan na hul banke, om weer deur ander gevolg te word. So is almal agtereenvolgens by die tafel bedien. Hierdie heen-en-weer stappery was bepaald baie onstigtelik veral waar die predikant by elke sitting ‘n afsonderlike tafeltoespraak moes hou. ‘n Nagmaalsdiens het in daardie tyd maklik drie uur geduur. 1) Ds. J.R. Albertyn van Riversdal was die eerste persoon wat in 1888 daartoe oorgegaan het om die nagmaal gesamenlik en gelyktydig aan almal in die banke te laat bedien. Hierdie “nuwigheid” is deur baie predikante, onder meer ds. A.I. Steytler en dr. J.J. Kotze as onbybels en ongereformeerd beskou. By die Sinode van 1890 het daar ‘n warm debat hieroor gevolg. Alhoewel die meerderheid van die Sinode hierdie nuwigheid nie as onbybels beskou het nie, het die ou manier van bediening egter ‘n stadige dood gesterwe. 2) Die gebruik van aparte klein Nagmaalskelkies in die Ned. Geref. Kerk dateer uit die jaar 1918 tydens die griepepidemie toe die gesondheidsafdeling van Johannesburg-stad gevra het dat die hou van Nagmaal tydelik opgeskort moes word. Dr. W Nicol van die Irenegemeente het die Nagmaalservies van die Presbiteriaanse buurgemeente vir diè geleentheid geleen. Dit het soveel byval gevind dat sonder ‘n rings- of sinodale besluit dit algemene gebruik geword het. 3) Die ou mense was ook baie lief om die Nagmaal op Paassondag en Kersdag te vier. 4) 1. Smit-lesing. 2. Smit-lesing. 3. Vgl. Meiring, Piet – My buurman se Kerk (1973) bl. 7 4. Smit-lesing. 1.3 DOOP BY DIE GEBOORTE Die Kraamvrou wat met ‘n veeboer getroud was, is soms slegs deur ‘n Hottentotvrou as vroedvrou bygestaan. 1) Aan die Kaap is die moeder van die pasgebore kind “gekerk”. Hierdie gebruik sluit aan by die kerkgang-gebruik was as openingsgebruik in Nederland gehandhaaf is. Die Kaapse moeder is omstreeks drie weke ná haar bevalling “gekerk”. Die handeling het bloot uit ‘n besoek aan die kerk bestaan. Tot in die agtiende eeu is hierdie gebruik aan die Kaap gehuldig. Ná die kerkgang het die moeder by haar vriende gaan besoek aflê; sy is sodoende dus weer in die samelewing opgeneem: “Aan die einde van drie weke word hulle (die kraamvroue) gekerk, soos ons sê, en dan kuier hulle oral in die nedersetting rond”. BY DIE DOOPVRONT Die doop van kinders het nie net op Sondae nie, maar ook op weeksdae, plaasgevind. 2) Gedurende die eerste jare, toe die kerk naby die Kaap nog binne die bereik van ons mense was, was dit gebruiklik om ‘n kind so gou moontlik ná die geboorte, d.w.s. die eerste Sondag na geboorte, ten doop te bring. Vanselfsprekend kon die moeder dan nog nie teenwoordig wees nie. Die vader het die kind self ten doop gebring en was dikwels vergesel deur een of meer van die doopgetuies of peetouers. 3) In die oudste doopformulier staan by vraag 3 aan die ouers: “vader (moeder) en getuie”. Eers later en veral op die platteland is die doop uitgestel sodat die moeder ook teenwoordig kon wees. 4) 1. Vgl. Mentzel O.F. Description (V.R.V.) III bl. 25 en 117 by Grobbelaar P.W.. c.s. – Boerewysheid bl. 134. 2. Vgl. Knappert, L. Huiselijk Leven II bl. 99 by Grobbelaar a.w. bl. 139. 3. Smit-lesing. 4. Smit-lesing. Die plattelanders kon nie altyd pas ná die geboorte hul kinders laat doop nie: “As ‘n vrou mettertyd aan ‘n kind geboorte gee, word die doop uitgestel tot lank na die bevalling; of dit kan miskien gebeur dat ‘n paar weke, maande of jare verbygaan voor die ouers kerk toe reis om die kind te laat doop; die vader tree as peetvader op en die moeder dra die kind na die doopvont”. 1) Die boere uit die binneland wat selde dorp toe kon kom, het dus soms noodgedwonde kinders wat reeds kon loop, laat doop. In sulke gevalle het albei ouers die doopplegtigheid bygewoon. As die vader nie aanwesig was nie, het dit opspraak in die samelewing verwek. 2) DIE DOOPGETUIES Die aanwys van peetouers is natuurlik ‘n geërfde stamlandse gebruik en die Kaapse vorm stem in alle besonderhede met die Nederlandse ooreen. Op die doopdag het die vader en peetvader saam na die kerk gestap, gevolg deur ‘n slavin wat die kindjie dra. Die peetvader het plegtig die predikant se vrae beantwoord. 3) Die doopgetuies het as peetouers ‘n belangrike rol vervul. Gewoonlik was hulle by die doopgeleentheid teenwoordig en vandaar die benaming doopgetuies. Hul het gewoonlik nie versuim om ‘n doopgeskenk, die sg. “pillegift” (pille – peetkind) te gee nie, wat op die platteland meermale uit een of meer stuks vee bestaan het. 4) 1. Vgl. Mentzel Description III bl. 117 by Grobbelaar a.w. bl. 140. 2. Vgl. Mentzel Description III bl. 5 en 122 by Grobbelaar a.w. bl. 140. 3. Vgl. Schotel, G.D.J. Huisgezin bl. 50 en Kolb Beschrijving bl. 169 by Grobbelaar a.w. bl. 140. 4. Smit-lesing. Onder die Kaapse veeboere is die tradisionele Nederlandse “pillegift” nog verder vervorm. Op haar huweliksdag het die dogter al die aanteel van haar pillegift na die nuwe opstal saamgeneem. Aan dogters is meestal verse en koeie as pillegift gegee, maar nie meer deur ‘n peetouer nie – deur haar eie vader. Hierdie Afrikaanse verskil ten opsigte van die stamlandse pillegift moet moontlik verklaar word uit die gebruik dat meisies dikwels nie gelykop met seuns ge-erf het nie. Aan ‘n seun is as geboortegeskenk dikwels ‘n perdemerrie gegee, ook deur sy vader. Seuns het vroeg behoefte aan ryperde gehad, vir hul daaglikse arbeid, die jag en die harde noodsaak van die lewe. Moontlik het die vader die pillegift gegee omdat peetvaders eenvoudig nie bekom kon word nie. 1) Ná die middel van die agtiende eeu was die gee van geskenke by ‘n geboorte (of die doop) nie meer ‘n algemene gebruik aan die Kaap nie – “ook word nie altyd van die peetouers verwag om pillegiften te gee nie, en die moeder kry geen geskenke na die bevalling nie”. Moontlik het die tradisioneel groot huisgesinne asook ander ekonomiese redes hierdie gebruik laat verval. 2) Op die platteland was daar geen doopmale nie. Tussen die jare 1705 en 1713 toe Kolb aan die Kaap was, het hy geen doopmale onder die Kapenaars waargeneem nie. “Men weet hier van kindernoch doopmalen en de ouders sijn, door zulke omstandighede, niet tot het maken van werkelijke onkonsten genoodzaakt”. Kolb noem ekonomiese redes vir die afwesigheid van die gebruik aan die Kaap. Hierdie erfsede sou egter nie daarom alleen verdwyn het nie, hoewel ekonomiese oorwegings dikwels ‘n vername aanleiding tot verval is. Kolb het waarskynlik aan die bevolking op die platteland gedink; onder hierdie koloniste is die doopfees heel verstaanbaar nie in stand gehou nie. Dit was net prakties onmoontlik weens die afgesonderde woontoestande. 3) 1. Vgl. Mentzel Description III bl. 112 by Grobbelaar a.w. bl. 141. 2. Vgl. Mentzel Description III bl. 121 – 122 by Grobbelaar a.w. bl. 141. 3. Vgl. Kolb Beschrijving bl. 271 by Grobbelaar a.w. bl. 143. Uit die ou doopregisters blyk die volgende Interessante Gebruike: (a) ‘n Groot getal doopgetuies (sewe en selfs meer). (b) Die vaste patroon wat gevolg is met die gee van die familiename. (c) ‘n Ander opvallende feit is dat die datum van die doop in die oudste doopregisters aangegee word, maar nie die geboortedatum nie. Dit was eers nadat De Mist in sy Kerkorde van 1804 dit vereis het, wat die geboortedatum ingeskrywe is. 1) 1.4 DIE HUWELIK DIE HUBARE LEEFTYD In die Kaapse samelewing het die meeste pare op besonder jeugdige leeftyd getrou. Dit blyk uit gegewens in die huweliksregisters in die Kaapse Argief. Nie alleen die tradisionele Nederlandse gebruik was hiervoor verantwoordelik nie. Dit is waarskynlik bevorder deur die oorwig van mans; die paar meisies wat die Kaap bereik het, is spoedig in die eg verbind. 2) Jong pare kon maklik selfstandig begin boer, en die pionierslewe het tot vroeë rypheid gelei. Vir die boere moes kinderrypheid ook van ekonomiese betekenis gewees het, aangesien die werkkrag van kinders veel goedkoper as dié van knegte en slawe was. 3) DIE VERLOWING Die verlowingsgebruike wat in hierdie tyd in Nederland gegeld het, was verstaanbaar ook meestal op die kolonies van toepassing: “In die kolonien volgde men zoo goed mogelijk de 1. Smit-lesing. 2. Vgl. Grobbelaar a.w. bl. 147. 3. Vgl. Hattingh, S.C. Minnespel bl. 13 by Grobbelaar a.w. bl. 147. gewoonten van het moederland. Zoo vertelt een Zweedsch reisiger ons van de Kaap a. 1773, dat geen kolonist mocht huwen zonder goedkeuring van den gouverneur, dat hij het verzoek kon indien en des Donderdags, dat daarop des Zaterdags aan het paar een orden wordt gegeven voor de Raad, die de verboden graden onderzoekt, waarna de gouverneur beveelt de geboden afte kondigen”. 1) In Desember 1676 is egter ‘n huwelikshof onder toesig van die Politieke Raad ingestel om hierdie taak te onderneem. 2) Die Huwelikshof moes elke Saterdag vergader en die volgende vrae aan die paartjies stel: hoe oud hulle is; of hulle ouers nog lewe; of hulle hul ouers se toestemming het; of hulle nie verwante van mekaar is nie ( om te waak teen bloedskande); en of hulle vry is om te trou. Niggies en Neefs wat in die huwelik wou tree, moes byvoorbeeld spesiaal die Huwelikshof se toestemming verkry. Daar is verder seker gemaak dat die ouers van albei wel toestemming gee indien hulle nog onmondig was, en dit was gewoonlik die geval omdat mondigwording destyds eers op die ouderdom van vyf-en-twintig jaar plaasgevind het. 3) Nadat alles deur die Huwelikshof in orde bevind was, kon die paartjie amptelik verloof raak, en dit is – soos in Nederland – die ondertrouw genoem.4) Hierdie gebruik was ‘n kontrak tussen die man en die vrou, volgens die Romeins-Hollandse reg, en dit was wetlik bindend. Teen die einde van die Nederlandse Tydperk in Suid-Afrika het die ondertrouw verval. 5) ‘n Onderdeel van die agtiende-eeuse Nederlandse huweliksfees was die commissarismaal, wat ‘n soort inleiding tot die eintlike 1. Vgl. De Coning, J A Hofmakery, Bl. 16 by Grobbelaar a.w. bl. 147 2. Vgl. Grove, C J Karoobruilof, bl. 15 by Grobbelaar a.w. bl. 147 3. Vgl. Grobbelaar a.w. bl. 147 4. Vgl. Grobbelaar a.w. bl. 148 5. Vgl. Grobbelaar a.w. bl. 148 huweliksfees gevorm het. Die commissarismaal is só genoem omdat dit gewoonlik gehou is op die aand van die dag waarop die paartjie voor die huwelikskommissarisse verskyn en toestemming tot die huwelik verkry het. Dit is dus op ‘n Saterdagaand gevier. 1) In die algemeen was die verlowing onder die boere op die platteland egter iets informeels, omdat dit nog geensins as deel van die werklike huwelik beskou is nie. Geen gelukwensinge is gevolglik deur die ouers verwag nie. ‘n Verlowing is ook eers erken nadat die eerste huweliksgebod in die kerk afgelees was, want dan het die gemeente geweet dat albei ouerpare hul toestemming tot die voorgenome huwelik gegee het, en dat dit ook deur die Kaapse Huwelikshof goedgekeur is. Dan kon vriende miskien na die bruid se ouerhuis gaan om die aanstaande egpaar geluk te wens. 2) DIE HUWELIKSGEBOOIE Die huweliksgebooie het drie Sondae na mekaar in die kerk “geloop”. Maar, anders as in Nederland, moes ‘n huwelik ook by die naaste drosdy aangemeld word. 3) DIE HUWELIKSBEVESTIGING Die huweliksbevestiging aan die Kaap het gewoonlik Sondae na die oggenddiens in die kerk plaasgevind. Daar was dikwels meer as een paartjie, en hulle is dan opgeroep om voor die kansel te verskyn. Nadat die predikant die formulier gelees het, het die bruidegom en bruid mekaar se regterhande gevat en die huweliksbelofte afgelê, waarna die predikant die seën oor hulle uitgespreek het. Hiermee was die plegtigheid afgeloop, want die huweliksregister is eers van die dertigerjare van die negentiende eeu af geteken. Ná die predikant se seën, het die paartjies weer hul plekke in die kerk ingeneem en gewag dat die diens beëindig word. 4) 1. Vgl. Grobbelaar a.w. bl. 149 2. Vgl. Grobbelaar a.w. bl. 150 3. Vgl. Grobbelaar a.w. bl. 151 4. Vgl. Grobbelaar a.w. bl. 152 Kolb vermeld dat die trouplegtigheid op die dag van die derde gebod plaasgevind het. Ook Mentzel het opgemerk dat huwelike op die derde Sondag van die huweliksgebooie voltrek is. Hy vermeld dat die paar in die namiddag getroud is, nadat die derde en laaste gebod by die oggendgodsdiens afgekondig is. 1) DIE HUWELIKSOPTOG Op die platteland het ‘n verloofde paar omstreeks die jaar 1735 toe Mentzel aan die Kaap was, op ‘n halftoe ossewa (tentwa) kerk toe gery. ‘n Touleier en drywer het hulle vergesel. 2) Die beskrywing geld heel waarskynlik vir ‘n huwelik in die buitewyke van Stellenbosch waar Mentzel ‘n ruk vertoef het. Sommige plattelandse bruidspare het dus op ossewaens gery, terwyl meer gegoedes agt perdewaens gebruik het. 3) In sulke gevalle was daar nie meer van ‘n huweliksoptog sprake nie, aangesien die rit om by die predikant op die dorp te kom, bloot ‘n praktiese noodsaaklikheid was. 4) VERSIERING Die reisiger Mentzel het ‘n beskrywing van ‘n Kaapse bruidskroon nagelaat. Hy skryf dat dit sonder veel moeite gevleg is, en waar die tradisionele mirte- en palmblare aan die Kaap onverkrygbaar was, is die takke van enige wilde immergroen plant en “zevejaars”-blommetjies vir dié doel gebruik. 5) Graham Botha skryf dat die bruidskamer aan die Kaap met blomme versier is. Bokant die roosmaryn van die bruidskamer is groen takkies mirte, lourier of roosmaryn gehang; in hierdie takke is papier- en kunsblomme ingevleg. 6) 1. Vgl. De Coning. Hofmakery bl. 18 by Grobbelaar a.w. bl. 151-2 2. Vgl. Hattingh. Koesinte bl. 13 by Grobbelaar a.w. bl. 153 3. Vgl. Hattingh. Verloof bl. 18 by Grobbelaar a.w. bl 153 4. Vgl. Hattingh. Verloof bl. 13 by Grobbelaar a.w. bl. 153 5. Vgl. Grobbelaar a.w. bl. 154 6. Vgl. Spoelstra, B: Volkslewe bl. 41. Schultz. Opsitkers bl. 12; by Grobbelaar a.w. bl. 154 By ‘n plattelandse bruilof aan die Kaap is daar gekleurde linte as versiering aangewend. Die drywer van die bruidswa se hoed en sweep is met linte opgetooi. Soms is linte aan die osse se horings vasgebind. 1) HUWELIKSFEES In die agtiende eeu het die huweliksfees aan die Kaap op die aand van die huwelik, ‘n Sondagaand, by die bruid se ouerhuis plaasgevind, presies soos die gebruik in die stamland was. In die algemeen was die Kaapse samelewing aan die begin van die agtiende eeu welvarend, met die gevolg dat bruilofte op taamlik groot feestelike skaal kon plaasvind. Die rykdom en stand van die bruid se vader het die aard van die huweliksfees bepaal. 2) Aan die Kaap het die strooipaar die bruid en bruidegom op baie maniere bygestaan. Hulle het byvoorbeeld die kranse en die skild gemaak en die bruid se ouerhuis versier. Teen eenuur op die huweliksnag het die bruid se vriendinne haar gehelp ontklee. Onder die veeboere, so vermeld Mentzel, het vriende die nuwe egpaar gehelp om ‘n eie huis te bou, aangesien geen slawe op dié voorposte beskikbaar was nie. Die veeboere het op dié manier ‘n ou Nederlandse gebruik van gemeenskapshulp bly handhaaf. 3) Aan die Kaap het ook ‘n openingsgebruik bestaan. Die oggend na die huweliksnag het bure en vriende gekom om die pasgetroude paar geluk te wens. Vervolgens is ‘n maaltyd aan hierdie gaste voorgesit. Daar is soms selfs weer gedans soos die vorige aand, en daarna is die egpaar as lede van die kring van getroudes aanvaar. 4) HUWELIKSGESKENKE Onder die Kaapse veeboere is die oorgeërfde vaderlandse vorm van die bruidskat vervorm sodat dit ook op die bruidegom van toepassing was. Die vader het by sy huwelik aan sy seun ‘n geskenk 1. Vgl. Heese, J:A: Worcester bl. 32 by Grobbelaar a.w. bl. 154 2. Vgl. Grobbelaar a.w. bl. 156 3. Vgl. Grobbelaar a.w. bl. 159 4. Vgl. Hattingh S:C: Onder die vierkleur bl. 19 by Grobbelaar a.w. bl. 158 18 gegee: “As daar geen beswaar gemaak is nie (dit wil sê deur die Huwelikshof) en die huwelik dus gereël was, het die bruidegom se vader soveel tot die huwelik bygedra as wat in sy vermoë was. ‘n Span van ses, agt of tien osse en ‘n wa was ‘n belangrike geskenk”. Hierdeur het die vader sy seun dus in staat gestel om sy eie boerdery op die voorposte te begin. Die veeboer-vader het ook aan sy dogter op gebruiklike wyse ‘n bruidskat in die ware sin van die woord gegee. Aanteelvee, wat hoofsaaklik uit verse en koeie bestaan het, is by haar huwelik aan ‘n dogter geskenk. So ‘n bruidskat kon uit ‘n honderd skape en ‘n paar ramme bestaan. Dié soort bruidskat was ‘n kenmerkende, eiesoortige gebruik net by die veeboere. 1) 1.5 BEGRAFNISSE Op die afgeleë platteland was daar nie sprake van besondere formaliteite by sterfgevalle nie. Die predikant of landdros moes net dadelik van ‘n sterfgeval verwittig word. 2) DIE BEGRAFNISBRIEFIE Dit was gebruiklik dat die koster – netjies uitgevat met steekhoed, kort broek en lang sykouse, swart manel en lae skoene met silwer gespes – met die begrafnisbriefie van huis tot huis gaan om “u edele en zoons” na die plegtigheid uit te nooi. Slegs manspersone het destyds die teraardebestellings bygewoon. Vroue het wel later die lykdiens in die kerk bygewoon, maar nie “agter lyk” gegaan nie. 3) ROU- EN KLEREDRAG Slegs swart klere was destyds betaamlik vir begrafnisse. Swart lanfers het van die draers se pluiskeile tot op hul heupe gehang, terwyl elkeen swart handskoene gedra het. 4) 1. Vgl. Grove. Karoobruilof bl. 15 by Grobbelaar a.w. bl. 158 2. Mentzel Description III bl. 120 by Grobbelaar a.w. bl. 164 3. Smit-lesing 4. Smit-lesing. Swart, asook wit, is in dié tyd as roukleure aan die Kaap gedra – net soos in die stamlande. 1) Aan die Kaap in die agtiende eeu het geen vasgestelde routyd bestaan nie. In sommige gevalle is die routyd nogtans op ‘n jaar vasgestel. Vir die eerste ses maande is daar “swaar” gerou, daarna is “ligte” rougewaad aangetrek. Nege maande ná die dood van haar man kon ‘n Kaapse weduwee hertrou. ‘n Kind se huwelik is gewoonlik tot ses maande ná die dood van ‘n ouer uitgestel.2) Die doodkis was gehul in ‘n eenvoudige swart lakenkleed, sonder ‘n enkele blomkrans. Blomkranse is ‘n Engelse gebruik wat eers later in gebruik gekom het. 3) BEGRAFNISDIENS EN TERAARDEBESTELLING In die sewentiende eeu is die Nederlandse hoëlui in die aand begrawe. 4) Ook aan die Kaap – tot die helfte van die agtiende eeu – het begrafnisse soms nog in die aand plaasgevind. Fakkels is deur mense in die stoet gedra, maar omdat die gebruik brandgevaar vir die Kaapstadse grasdakhuise ingehou het, is dit deur die owerheid verbied. 5) Hier is die oorgeërfde gebruik dus weens landsomstandighede gewysig. Voortaan moes alle begrafnisse gedurende die dag plaasvind. Lykdienste was vroeër nie gebruiklik nie. 6) Aan die Kaap was daar maar min seremonies by die graf. Bowendien was predikante skaars. Die lang Nederlandse lykrede aan die Kaap het ook verval. Nadat die kis in die graf neergelaat was, het die omstanders volgens die ou gebruik ‘n paar handevol grond daarop gegooi (die stof wat tot stof wederkeer, volgens die Christelike geloof), en dan het die grafgrawer die graf opgevul. 7) 1. Grobbelaar Swartland bl. 165 2. Mentzel Description II bl. 123 Grobbelaar a.w. bl. 18 3. Smit-lesing 4. Vgl. Hofdijk, W.J. Voorgeslacht bl. 189 by Grobbelaar a.w. bl.171 5. Vgl. Botha C.G. Social Life bl. 66 by Grobbelaar a.w. bl. 171 6. Smit a.w. 7. De Kock: Die Huisgenoot 5.11.37 bl. 23 by Grobbelaar a.w. bl. 176: en Botha Social Life bl. 104 Die Kaapse plaasbegrafnisse was nóg armer aan seremonies. Meestal is boere deur familiebetrekkinge begrawe, gewoonlik omdat die dienste van predikante nie verkrygaar was nie. Mentzel skryf soos volg oor toestande op die platteland omstreeks 1745. “Die oorledene word, indien die mense nie te ver van die kerk af woon nie, na Kaapstad gebring en begrawe, of na Stellenbosch, Drakenstein of Swellendam. Diegene wat egter op verafgeleë plekke gesterf het, word op hul plase begrawe. Die grafte moet diep genoeg gegrawe wees en word met groot klippe bedek. Op die platteland is die begrafnisgebruike en –seremonies net so min in die mode as swaar en ligte rou”. Die diep grafte en klippe was natuurlik bedoel om aasdiere weg te hou. 1) DIE DRAERS Draers het gewoonlik ‘n half-uur voor die tyd by die sterfhuis byeengekom. Daar het hulle hul lanfers en swart handskoene, asook ‘n muntstuk as vergoeding ontvang, terwyl hul boonop op wyn en koek getrakteer is. 2) RANGORDE IN DIE LYKSTOET In die opstel van die lykstoet moes sorg gedra word dat, veral die rouklaers, volgens hul rang en status in die samelewing geplaas word. 3) ROUKLAERS In daardie dae is mense spesiaal gehuur om by ‘n begrafnis rou te bedryf. Van hulle is verwag om openlik soveel verdriet as moontlik te toon. Daar was twee soorte rouklaers: “Die Huilebalken” en die “Tropsluiters”. Laasgenoemde het gewoonlik paarsgewyse die agterhoede van die stoet uitgemaak. Omdat daar ‘n bygeloof was dat die persoon wat heel agter in die stoet loop die eerste sou sterf, het die tropsluiters gedurig plekke verwissel om sodoende die risiko sover moontlik te verminder. 4) 1. Mentzel: Description III bl. 117 – 118 by Grobbelaar a.w. bl. 176 2. Smit-lesing 3. Smit-lesing 4. Smit-lesing BEGRAAFPLAAS Die oudste dode-akkers was binne die ringmuur van die kerk (vandaar kerkhof). Daar was ‘n tyd dat lyke selfs binne-in die kerk begrawe is. 1) Verder was dit ‘n algemene gebruik aan die Kaap, in die sewentiende eeu, veral, om lyke so naby as moontlik aan die kerk te begrawe ten einde te verseker dat hulle veilig (teen die bose) sou wees, en dat hulle siele rus sou vind, omdat die lyke op geheiligde grond (kerkgrond) ter aarde bestel is. Die algemene gedagtegang aan die Kaap in dié verband vertoon groot ooreenkoms met die Nederlandse van dieselfde tykperk. 2) Aan die voet van Tafelberg is ‘n begraafplaas afgesonder waar boere begrawe is. Hier naby het die koster se huis gestaan. Reeds in die sewentiende eeu is ‘n aparte kerkhof vir matrose, soldate en vreemdelinge wat aan die Kaap gesterf het, aangelê. Die begraafplaas het as die vreemdelinge-begraafplaas of matrosen kerhof bekend gestaan. Vroeg in die agtiende eeu besluit die Politieke Raad om ‘n nuwe matrosen kerkhof aan te lê en die oue tot niet te maak omdat dit te midde-in die groeiende dorp geleë was. As gevolg van die pokke-epidemie van 1755, moes ‘n volgende begraafplaas aan die huidige Grafstaat – vandaar die naam – aangelê word. Ook private grafkelders word deur gegoede burgers weg van die kerk opgerig. ‘n Grafkelder is byvoorbeeld by Saasveld in Kloofstraat, Kaapstad aangelê omdat die kerkhof van die kerk oorvol was. 3) GRAFSTENE EN GRAFTE Die vaderlandse gebruik om grafstene op te rig, is dus aan die Kaap gehandhaaf. Ook is rouborde in die kerk aangebring, ensovoorts. Op die grafsteen verskyn gewoonlik die naam, stand, geboorte- en sterfdatum, die lewenswerk, die familiewapen, en aan die kante allerlei versierings in die modestyle van die tyd. Die meeste ou 1. Smit – lesing 2. Botha: Social Life bl. 20 by Grobbelaar a.w. bl. 172. 3. Leibrandt H.C.V. Rambles bl. 151 by Grobbelaar a.w. bl. 174. Grafskrifte is egter verlore. Ons kan tog aanneem dat hulle ooreenkoms met die tydgenootlike stamlandse vorms vertoon het. Plaasgrafte was – soos ons gesien het – uiters eenvoudig, bloot met ‘n paar klippe bedek om die hyenas en ander aasdiere weg te hou. Uit praktiese oorwegings is dus ‘n nuwe gebruik geskep. 1) DIE BEGRAFNISMAAL Tot vandag toe staan geelrys met rosyntjies bekend as begrafnisrys. Dit herinner aan die tyd toe daar ná afloop van die begrafnis ‘n weelderige begrafnismaal aan die sterfhuis gegee is. By sulke geleenthede is die begrafnisganger ryklik getrakteer op die smaaklikste kossoorte, geregte, om nie te praat van die beste wyne nie! Veral die vooraanstaandes het met mekaar gewedywer, sodat die owerheid in 1753 met praalwette moes ingryp om paal en perk aan hierdie duur en swierige begrafnisse te stel. 2) 1.6 DIE BYBEL EN ANDER GODSDIENSTIE BOEKE Al was boeke skaars op die platteland en al het die boere nie gelees nie – het nagenoeg elke familie ten minste ‘n Bybel besit. In 1820 skrywe Mary Moffat, die vrou van die beroemde sendeling, uit Beaufort Wes aan haar ouers: “I think I never saw so many finelooking Bibles in my life as since I came to Africa. They seem to have a particular pride in them”. 3) Naas die massiewe Statebybel, wat met die grootste sorg opgepas is, kon daar in die meeste huise ook die gesange van Willem Sluiter, die Heidelbergse Kategismus en die kortbegrip van Helmbroek aangetref word. Sommige families het ook nog een of ander predikasieboek besit. Die bekendste hiervan was die “Donderslag der Goddelozen”. 1. Leibrandt. H.C.V. Rambles bl. 182 by Grobbelaar a.w. bl. 181. 2. Smit-lesing. 3. Moffat: The Lives of Robert and Mary Moffat, p.74 by van der Merwe a.w. p. 247. 1.7 KERSFEES EN NUWEJAAR “The colonists do not keep Christmas but everyone goes about his business as usual, but New Year’s day is thus far kept as a holiday that on this day neighbours visit each other" 4) q99zwlv18hrbteajj4ux0owtv6s56nr Gebruiker:AmaryllisGardener 2 2596 4771 2013-11-17T14:23:23Z AmaryllisGardener 1302 Editing global userpage 4771 wikitext text/x-wiki {{#babel:en|sco-2|pih-1|nov-1}} b0yvcx7beool1djayxe8ixy1apoijrs Gebruiker:Jayantanth 2 2597 4774 4772 2013-11-18T14:17:01Z PiRSquared17 555 Fixing userpage (per request). 4774 wikitext text/x-wiki {{#babel:bn|en-1}} <div class="mw-content-ltr" lang="en" dir="ltr"> Hello. I do not edit here much. You can find me on [[m:bn:User:Jayantanth|the Bengali Wikipedia]] or [[m:User:Jayantanth|Meta]]. </div> <!--This can be used to make a redirect arrow.-->[[File:Redirect arrow without text.svg|46px|link=]][[m:bn:User talk:Jayantanth|w:bn:{{ns:3}}:Jayantanth]] ([[m:w:User talk:Jayantanth|en]], [[m:User talk:Jayantanth|Meta]]) iswgnavz6i0274lvy2730ubtx5kv9qb Gebruiker:TBloemink 2 2601 4778 2013-11-25T12:41:31Z TBloemink 721 Editing global userpage 4778 wikitext text/x-wiki <!--This is just an example. Edit it to make it yours. PLEASE CHANGE THE BABEL AND CONTENT. THIS IS 100% YOUR RESPONSIBILITY. --> <div class="mw-content-ltr" lang="en" dir="ltr">Hello. I do not edit here much, but I am a member of [[m:Special:MyLanguage/Small Wiki Monitoring Team|the Small Wiki Monitoring Team]]. You can find me on Meta [[m:User:TBloemink|here]]. </div> [[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:TBloemink|m:{{ns:3}}:TBloemink]] qybcofzlzv3draz0hxv2g3uclqg09za Gebruikerbespreking:*Youngjin 3 2607 5272 4790 2017-12-06T21:02:55Z -revi 1254 -revi het bladsy [[Gebruikerbespreking:분당선M]] na [[Gebruikerbespreking:*Youngjin]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5272 wikitext text/x-wiki <div style="border:1px solid; background-color:#E8E8E8; margin:10px; padding:10px"> [[File:Gnome-help-faq.svg|100px|left]] <big> ''' NOTICE''' I am not active in here exapt SWMT works. So I may not replay quicly, Instead please visit my [[m:user talk:분당선M|Meta-wiki user talk page]]. Thank you </big> qhdktpypuswez5axawcgeouy42wixwq Gebruiker:La fée Didier/common.js 2 2608 5233 4794 2017-02-15T22:16:53Z Litlok 1804 Litlok het bladsy [[Gebruiker:Morphypnos/common.js]] na [[Gebruiker:La fée Didier/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Morphypnos|Morphypnos]]" to "[[Special:CentralAuth/La fée Didier|La fée Di... 5233 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Morphypnos/global.js&action=raw&ctype=text/javascript'); qrxr6dgh3gg23pvlzua88n4xx2yk05f Gebruiker:JøMa/common.css 2 2611 4799 2014-01-20T21:41:22Z Pathoschild 29 global CSS ([[m:User:Pathoschild/Scripts/Synchbot|requested by JøMa]]) 4799 css text/css @import "//de.wikipedia.org/w/index.php?title=User:JøMa/global.css&action=raw&ctype=text/css"; b6im9giy1jl9jqfj9p8k1krtlppdc20 Gebruiker:Jmvgpartner/common.js 2 2615 4804 2014-01-21T00:46:55Z Pathoschild 29 global JavaScript ([[m:User:Pathoschild/Scripts/Synchbot|requested by Jmvgpartner]]) 4804 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Jmvgpartner/global.js&action=raw&ctype=text/javascript'); 973biicq1oyeknwznhafa9banyrg90m Gebruikerbespreking:Alan 3 2617 4807 2014-01-21T10:16:39Z Alan 1242 Editing global usertalk page 4807 wikitext text/x-wiki {{#babel:es-N|en-2|eu-3}} [[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Alan|m:User talk:Alan]] k199yb4edrodawb5z4jl9cueesbzddb Gebruiker:Jonathunder 2 2620 4813 2014-01-31T02:15:06Z Jonathunder 1305 {{#babel:en||af-0}} 4813 wikitext text/x-wiki {{#babel:en||af-0}} famdo7oyerdwlotvmyg4m5c4hjhlaup Gebruiker:Iluvatar 2 2622 4818 2014-02-14T13:22:36Z Iluvatar 1344 Editing global userpage 4818 wikitext text/x-wiki {{#babel:ru-N|en-1|be-1|}} <div class="mw-content-ltr" lang="en" dir="ltr">Hello. I do not edit here much, but I am a member of [[m:Special:MyLanguage/Small Wiki Monitoring Team|the Small Wiki Monitoring Team]]. You can find me on Meta: [[m:User:Iluvatar]]. </div> [[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Iluvatar|m:{{ns:3}}:Iluvatar]] 2u2txozbl1ux8kpr7mp9i86e0b9h4kr Gebruiker:Randykitty 2 2624 4822 4821 2014-02-28T05:01:06Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Randykitty]]) 4822 wikitext text/x-wiki Please click<br>→ [[m:w:en:User:Randykitty|'''here''']] to visit my user page on my English home wiki,<br>→ [[m:w:en:Talk:Randykitty|'''here''']] to access my talk page on my home wiki.<br><br>Thank you, Randykitty qlj5rkivvr1qfq7puri3vd4kcuim2q2 Gebruiker:Dusti 2 2627 4825 2014-02-28T07:02:32Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Dusti]]) 4825 wikitext text/x-wiki {{#babel:en|es-3}}[[File:Redirect arrow without text.svg|46px|link=]][[w:en:User:Dusti|w:en:{{ns:3}}:Dusti]] imzuc5l2cxomqg3bmsjnqupazotkb6p Gebruiker:Chmarkine/common.js 2 2628 4829 4826 2014-03-04T22:23:51Z Chmarkine 1349 4829 javascript text/javascript mw.loader.load('//en.wikipedia.org/w/index.php?title=User:Chmarkine/jshub.js&action=raw&ctype=text/javascript'); nw1175g01b62s8eprhrnteekx6h8tv9 Gebruikerbespreking:Chmarkine 3 2629 4827 2014-03-01T20:21:35Z Chmarkine 1349 Editing global userpage 4827 wikitext text/x-wiki __NOINDEX__ If you want to contact me, please leave me messages on [[m:en:User talk:Chmarkine|my English wikipedia user talk page]]. 2v7n4c7imjdtyecxxfl0ap2awpl6ew0 Gebruikerbespreking:Jianhui67 3 2630 4832 4831 2014-03-09T09:28:28Z Jianhui67 1353 4832 wikitext text/x-wiki If you have any questions, you are welcome to leave a message here. ''' <span style="color:red"> NOTICE: BEFORE YOU BLOCK MY ACCOUNT: IF MY EDIT SUMMARY INCLUDE PREFIX </span>''(Script)''<span style="color:red">, PLEASE DON'T BLOCK ME, JUST TELL ME TO SLOW DOWN AT [[commons:User talk:Jianhui67|MY COMMONS' TALK PAGE]]. </span> mw8k4hjrpyayf8m8estfr16rw8aghhb Gebruiker:Jaxxes 2 2631 4833 2014-03-13T23:55:11Z Jaxxes 1354 Editing global userpage 4833 wikitext text/x-wiki <div style="background-color:black; color:white; -moz-border-radius: 13px; border-radius: 11px; solid #000000; padding:5px; font new; font-size:95%; width:95%; margin:auto;" class="mw-content-ltr" lang="en" dir="ltr"> Sup. I'm [[wikia:central:User:Alpha God|<span style="color:#FF0000;">Alpha-God]] or on Wikimedia [[m:User:Jaxxes|<span style="color:#FF0000;">Jaxxes]] and I do [[m:Countervandalism Network|<span style="color:#FF0000;">counter-vandalism]] for Wikia and Wikimedia, meaning that if you are seeing this, I have probably been here cleaning up spam and/or vandalism. I am also an experienced member of the [[m:Small Wiki Monitoring Team|<span style="color:#FF0000;">SWMT]] so I might be doing counter-vandalism on small wikis. <br /><br /> Feel free to contact me on my [[wikia:central:Message Wall:Alpha God|<span style="color:#FF0000;">Wikia Message Wall</span>]] or [[m:User Talk:Jaxxes|<span style="color:#FF0000;">Meta User-Talk</span>]] if you have anything you need! b0c80xx890hjulrn9v02czklgvulew1 Gebruiker:Mazbel 2 2632 6518 4846 2020-04-17T05:15:09Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:Leitoxx]] na [[Gebruiker:Mazbel]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Leitoxx|Leitoxx]]" to "[[Special:CentralAuth/Mazbel|Mazbel]]" 4846 wikitext text/x-wiki <!--This is just an example. Edit it to make it yours. PLEASE CHANGE THE BABEL AND CONTENT. THIS IS 100% YOUR RESPONSIBILITY. --> {| style="width:238px" align=right |- | align="right" | [[File:Wikinews favicon.svg|15x15px|link=n:es:Usuario:Leitoxx]] [[File:Wikimedia Community Logo.svg|15x15px|link=m:User:Leitoxx]] [[File:Wikipedia-logo-v2.svg|15x15px|link=w:es:Usuario:Leitoxx]] [[File:Wiktionary-logo.svg|15x15px|link=wikt:es:Usuario:Leitoxx]] [[File:HSWBooks.svg|15x15px|link=b:es:Usuario:Leitoxx]] [[File:Commons-logo.svg|15x15px|link=commons:User:Leitoxx]] [[File:Incubator-logo.svg|15x15px|link=incubator:User:Leitoxx]] [[File:HSWQuote.svg|15x15px|link=q:es:User:Leitoxx]] [[File:HSWVersity.svg|15x15px|link=wikiversity:es:User:Leitoxx]] [[File:HSWSource.svg|15x15px|link=wikisource:es:User:Leitoxx]] [[File:Wikispecies 006.svg|15x15px|link=species:User:Leitoxx]] |}<br /> {{#babel:<!--ADD BABEL HERE, UPDATE LANGUAGE LIST before #default (see right:)-->es-N|pt-3|en-2}} <div class="mw-content-ltr" lang="en" dir="ltr">Hello. I do not edit here much, but I am a member of [[m:Special:MyLanguage/Small Wiki Monitoring Team|the Small Wiki Monitoring Team]]. You can find me on [[m:User:Leitoxx|Meta]] or [[w:es:User:Leitoxx|Wikipedia]].<!--Do not remove m: from link unless you know what you are doing (see docs for more info) --> </div> <!--This can be used to make a redirect arrow.-->[[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Leitoxx|m:{{ns:3}}:Leitoxx]] fo80vjbyiw9d9ag7q6p0c2v15snrnxp Gebruiker:Natuur12/vector.css 2 2637 4843 2014-04-03T21:59:23Z Natuur12 1341 Editing global userpage 4843 css text/css * { font-family: sans-serif; } h2#mw-previewheader, div#mw-usercsspreview strong { font-family: sans-serif !important; color: #c00 !important; } div#content #toc h2, div#content .toc h2, h2.diff-currentversion-title { font-family: sans-serif !important; } div.mw-geshi div, div.mw-geshi div span, div.mw-geshi div pre, span.mw-geshi, span.mw-geshi span, pre.source-css, pre.source-css span, pre.source-javascript, pre.source-javascript span, pre.source-lua, pre.source-lua span { font-family: monospace !important; -moz-tab-size: 4; } div#content { font-size: 93%; } h1#firstHeading { font-size: 1.6em !important; } div#content.mw-body { margin-left: 11.8em; color: #000; } textarea#wpTextbox1, pre { font-family: monospace; } /* Font size */ code a { font-family: monospace; font-size: 130%; } pre { font-size: 130%; } div#content h3 { font-size: 132%; } div#content h4 { font-sizeː 116%; } div#content h5 { font-size: 100%; } div#content h6 { font-size: 80%; } td.diff-deletedline, td.diff-addedline, td.diff-context { font-size: 85%; } 4ciwchmduyqbsol7vm6r1143zsm9r2a Gebruiker:JurgenNL/common.css 2 2640 4848 4847 2014-04-04T07:26:15Z JurgenNL 1201 Editing global css 4848 css text/css @import "//meta.wikimedia.org/w/index.php?title=User:JurgenNL/global.css&action=raw&ctype=text/css"; 7f2rb7kpwjtpaud5unzlfzgvmiyopcq Gebruiker:Tremonist 2 2643 4854 2014-05-07T13:12:10Z Tremonist 1382 Nuwe bladsy geskep met '<big>'''Tremonist'''</big>' 4854 wikitext text/x-wiki <big>'''Tremonist'''</big> i22mnidx37umo6xe5ui9a0jnyc7s23b Wikibooksbespreking:Gebruikersportaal 5 2644 4860 2014-05-19T20:38:31Z MediaWiki message delivery 1367 /* Using only UploadWizard for uploads */ nuwe afdeling 4860 wikitext text/x-wiki == Using only [[commons:Special:MyLanguage/Commons:Upload Wizard|UploadWizard]] for uploads == [[Image:Commons-logo.svg|right|220px|alt=Wikimedia Commons logo]] <div lang="en" dir="ltr" class="mw-content-ltr"> Hello! It was noted that on this wiki you have [[Special:Statistics|less than 10 local files]]. Presumably, you therefore don't have interest nor energies to have [[commons:Category:Licensing templates|hundreds templates]] with the [[mw:Multimedia/Media Viewer/Template compatibility|now required HTML]], even less a local [[m:EDP|EDP]]. However, this means that users here will experience a mostly broken and/or [[wmf:Resolution:Licensing policy|illegal]] uploading. I propose to * '''have [[Special:Upload|local upload]] [[commons:Commons:Turning off local uploads|restricted]]''' to the "{{int:group-sysop}}" group (for emergency uploads) and * the '''sidebar point to [[commons:Special:UploadWizard]]''', so that you can avoid local maintenance and all users can have a functioning, easy upload interface [[translatewiki:Special:Translate/ext-uploadwizard|in their own language]]. All registered users can upload on Commons and [[Special:ListFiles|existing files]] will not be affected. I'll get this done in one week from now. # If you disagree with the proposal, just [[m:User:Nemo bis/Unused local uploads|remove your wiki from the list]]. # To make the UploadWizard even better, please tell your experience and ideas on [[commons:Commons:Upload Wizard feedback]]. [[m:User:Nemo_bis|Nemo]] 20:38, 19 Mei 2014 (UTC) </div> <!-- Message sent by User:Nemo bis@metawiki using the list at http://meta.wikimedia.org/w/index.php?title=User_talk:Nemo_bis/Unused_local_uploads&oldid=8578536 --> mjm565uxpngrygcugc977nm8tr2n1pw Gebruiker:MoiraMoira 2 2645 4863 2014-06-16T15:03:25Z MoiraMoira 393 Nuwe bladsy geskep met 'global sysop; when around here helping out with vandalism/spam' 4863 wikitext text/x-wiki global sysop; when around here helping out with vandalism/spam 97khejce7pg4el5kbdtqo4mvyhl0p97 Gebruiker:Jalexander 2 2646 4867 2014-08-17T23:20:41Z MF-Warburg 42 MF-Warburg het bladsy [[Gebruiker:Jalexander]] na [[Gebruiker:Jalexander-WMF]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Jalexander|Jalexander]]" to "[[Special:CentralAuth/Jalexander-WMF|Jalexander-WMF]]" 4867 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Jalexander-WMF]] dlhrr57jfitnhd48xwat6c3k2kf9bup Gebruiker:Lotje 2 2647 4872 2014-08-23T13:17:50Z Lotje 1414 Nuwe bladsy geskep met '[[File:Redirect arrow without text.svg|46px|link=]][[w:User talk:Lotje|Lotje]]' 4872 wikitext text/x-wiki [[File:Redirect arrow without text.svg|46px|link=]][[w:User talk:Lotje|Lotje]] 7ld1xqc9qqxkg3g92cq0e2j44ds0ase Gebruiker:Good afternoon 2 2648 4873 2014-08-27T02:23:12Z Pathoschild 29 global user pages ([[m:User:Pathoschild/Scripts/Synchbot|requested by Good afternoon]]) 4873 wikitext text/x-wiki __NOINDEX__ Greetings! I'm most active on [[:w:zh:User:Good afternoon|Chinese Wikipedia]]. Please leave me messages there. Thank you! 5p9zn8ygjlpiez32knrqmg16jzgc3ps Gebruiker:Vanished user 9oijnsdfknefijh3tjasfi34 2 2650 5175 4882 2015-11-13T03:05:50Z Nihonjoe 539 Nihonjoe het bladsy [[Gebruiker:Romtam]] na [[Gebruiker:Vanished user 9oijnsdfknefijh3tjasfi34]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Romtam|Romtam]]" to "[[Special:Central... 5175 wikitext text/x-wiki <center>Hi there. If you want to contact me, please visit my talk page at [[m:w:en:User talk:Romtam|English Wikipedia]] or [[m:w:th:คุยกับผู้ใช้:Romtam|Thai Wikipedia]]. Thanks for visiting. <br /> สวัสดีครับ ถ้าคุณต้องการติดต่อผม ขอให้คุยที่[[m:w:th:คุยกับผู้ใช้:Romtam|วิกิพีเดีย]]ครับ ขอบคุณครับ <br /> [[File:BTS Surasak Aug2014.jpg|700px]]</center> kflhupopageql1pdurbu1tyspe6jq1i Gebruiker:Vajotwo 2 2652 4884 2014-09-14T15:44:48Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Vajotwo]]) 4884 wikitext text/x-wiki '''Hi, if you want to contact me, please visit my talk page at [[m:w:it:User talk:Vajotwo|Italian Wikipedia]]. Thanks for your attention''' 3x6177sgt4xcdumkkbdt95dxsj5r9n8 Gebruikerbespreking:Gruß Tom 3 2653 4885 2014-09-15T15:37:30Z Gruß Tom 1115 Nuwe bladsy geskep met '[[File:WMF building wiki wall in August 2014 caricature.jpg|600px]] User inactiv thanks to WMF.--~~~~' 4885 wikitext text/x-wiki [[File:WMF building wiki wall in August 2014 caricature.jpg|600px]] User inactiv thanks to WMF.--[[Gebruiker:Gruß Tom|Gruß Tom]] ([[Gebruikerbespreking:Gruß Tom|kontak]]) 15:37, 15 September 2014 (UTC) 1hmpy8zqockzuuux4qjhuxpomqwbnvg Gebruiker:Helder.wiki 2 2654 4890 4887 2014-09-16T05:49:17Z タチコマ robot 851 Robot: dubbele aanstuur na [[Gebruikerbespreking:He7d3r]] reggemaak 4890 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:He7d3r]] sgfb0zi4l77swnwz4ha0j42igmm6hkq Gebruikerbespreking:Helder.wiki 3 2655 4889 2014-09-15T18:08:34Z Vogone 1002 Vogone het bladsy [[Gebruikerbespreking:Helder.wiki]] na [[Gebruikerbespreking:He7d3r]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Helder.wiki|Helder.wiki]]" to "[[Special:CentralAuth/He7d3r|He7d3r]]" 4889 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:He7d3r]] sgfb0zi4l77swnwz4ha0j42igmm6hkq Gebruikerbespreking:Vanished user 9oijnsdfknefijh3tjasfi34 3 2656 5176 4892 2015-11-13T03:09:02Z Nihonjoe 539 Nihonjoe het bladsy [[Gebruikerbespreking:Romtam]] na [[Gebruikerbespreking:Vanished user 9oijnsdfknefijh3tjasfi34]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Romtam|Romtam]]" t... 5176 wikitext text/x-wiki <center>Hi there. If you want to contact me, please visit my talk page at [[m:w:en:User talk:Romtam|English Wikipedia]] or [[m:w:th:คุยกับผู้ใช้:Romtam|Thai Wikipedia]]. Thanks for visiting. <br /> สวัสดีครับ ถ้าคุณต้องการติดต่อผม ขอให้คุยที่[[m:w:th:คุยกับผู้ใช้:Romtam|วิกิพีเดีย]]ครับ ขอบคุณครับ <br /> [[File:BTS Surasak Aug2014.jpg|700px]]</center> kflhupopageql1pdurbu1tyspe6jq1i Gebruiker:Hym411 2 2659 4944 4918 2015-01-11T04:54:06Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Hym411]]) 4944 wikitext text/x-wiki #REDIRECT [[User:-revi]] r339x2g9slipcxm7q11japopjzpi6pw Gebruikerbespreking:Hym411 3 2660 4945 4919 2015-01-11T06:46:13Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Hym411]]) 4945 wikitext text/x-wiki #REDIRECT [[User talk:-revi]] shea9cfpoa30q9vjv11h8sym7toqb6g Gebruiker:Startupevo1 2 2663 4904 2014-10-13T13:37:22Z Pmlineditor 468 Pmlineditor het bladsy [[Gebruiker:Startupevo1]] na [[Gebruiker:Grind24]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Startupevo1|Startupevo1]]" to "[[Special:CentralAuth/Grind24|Grind24]]" 4904 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Grind24]] kj9tn1y6as9n0fzijkzpwid81yra4ui Gebruikerbespreking:Startupevo1 3 2664 4906 2014-10-13T13:37:22Z Pmlineditor 468 Pmlineditor het bladsy [[Gebruikerbespreking:Startupevo1]] na [[Gebruikerbespreking:Grind24]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Startupevo1|Startupevo1]]" to "[[Special:CentralAuth/Grind24|Grind24]]" 4906 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Grind24]] 8mppelna0nnqgn0klp4gou80qv95y3i Gebruiker:Conquistador/sandbox 2 2665 5177 5172 2015-11-17T02:22:51Z Conquistador 1448 page blanking 5177 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruiker:NahidSultan 2 2667 4981 4911 2015-02-14T18:57:24Z Pathoschild 29 global user pages ([[m:Synchbot|requested by NahidSultan]]) 4981 wikitext text/x-wiki {{DISPLAYTITLE:<span style="display:none;">User:</span><span style="font-family:Comic Sans MS;font-size:30px"><b><font color=green>Nahid Sultan</font></b></span>}} <div style="padding: 12px 18px 5px 15px; width: absolute; border: 2px solid #000; background: #F5F5F5; color: #000; text-align: justify;">Thanks for stopping by! The purpose of this user page is to point you to the right direction where you can contact me in need. Please do not leave your message here, otherwise in most cases, they will not be noticed in time and eventually be removed. However, you are encouraged to contact me or say hello. :-) Please note that I can communicate in either Bangla or English. My apologies for not knowing your language. If you prefer to leave me a message, please choose any of the following talk pages I maintain frequently. * [[m:User talk:NahidSultan|Meta-Wiki talk page]] * [[m:bn:User talk:NahidSultan|Bangla Wikipedia talk page]] * [[m:en:User talk:NahidSultan|English Wikipedia talk page]] * [[m:commons:User talk:NahidSultan|Wikimedia Commons talk page]] If you have something to say to me in private, e-mail is a good option. * If you are logged in to your Wikimedia account you can probably e-mail me by [[Special:EmailUser/NahidSultan|clicking here]]. Finally, If you have an IRC client, you can contact me there as well. I can be found in [irc://irc.freenode.net/cvn-sw #cvn-sw] and [irc://irc.freenode.net/wikimedia-commons #wikimedia-commons] on the Freenode IRC network, usually with the nick <code>NahidSultan</code>. Please be bold and talk.</font></center></div> 7g7jlke3se59pr3n34z6pd2eymm6gfy Gebruikerbespreking:NahidSultan 3 2668 4912 2014-11-05T06:45:57Z NahidSultan 1451 Nuwe bladsy geskep met '<div style="padding: 12px 18px 5px 15px; width: absolute; border: 2px solid #000; background: #F5F5F5; color: #000; text-align: justify;">The purpose of this user page is...' 4912 wikitext text/x-wiki <div style="padding: 12px 18px 5px 15px; width: absolute; border: 2px solid #000; background: #F5F5F5; color: #000; text-align: justify;">The purpose of this user page is to point you to the right direction where you can contact me in need. Please do not leave your message here, otherwise in most cases, they will not be noticed in time and eventually be removed. However, you are encouraged to contact me or say hello. :-) Please note that I can communicate in either Bangla or English. My apologies for not knowing your language. If you prefer to leave me a message, please choose any of the following talk pages I maintain frequently. * [[m:User talk:NahidSultan|Meta-Wiki talk page]] * [[m:bn:User talk:NahidSultan|Bangla Wikipedia talk page]] * [[m:en:User talk:NahidSultan|English Wikipedia talk page]] * [[m:commons:User talk:NahidSultan|Wikimedia Commons talk page]] If you have something to say to me in private, e-mail is a good option. * If you are logged in to your Wikimedia account you can probably e-mail me by [[Special:EmailUser/NahidSultan|clicking here]]. Finally, If you have an IRC client, you can contact me there as well. I can be found in [irc://irc.freenode.net/wikimedia-commons #wikimedia-commons] on the Freenode IRC network, usually with the nick <code>NahidSultan</code>. Please be bold and talk.</font></center> </div><!-- TA! --> knql5snjybjeo9t20260p7hmu8e90t2 Gebruiker:V(g) 2 2671 5218 5216 2016-08-25T09:50:32Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:G(x)-former]] na [[Gebruiker:V(g)]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/G(x)-former|G(x)-former]]" to "[[Special:CentralAuth/V(g)|V(g)]]" 5218 wikitext text/x-wiki [[File:Redirect arrow without text.svg|46px|link=]][[m:th:User:V(g)|w:th:{{ns:3}}:V(g)]] slukf703ujdbkhc42onrhxjkk50gtvz Gebruikerbespreking:V(g) 3 2672 5220 5217 2016-08-25T09:50:33Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruikerbespreking:G(x)-former]] na [[Gebruikerbespreking:V(g)]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/G(x)-former|G(x)-former]]" to "[[Special:CentralAuth/V(g)|V(g)]]" 5220 wikitext text/x-wiki [[File:Redirect arrow without text.svg|46px|link=]][[m:th:User talk:V(g)|w:th:{{ns:3}}:V(g)]] 0a8ll03hwd1s0o95bb7tbg7ww2ctts0 Gebruiker:Holder 2 2673 4925 4924 2014-11-26T06:39:16Z Holder 436 4925 wikitext text/x-wiki {{#babel:als|de-4|en-3|af-0}} Hello, I'm [https://als.wikipedia.org/wiki/Benutzer:Holder Holder], administrator (sysop) and bureaucrat from [https://als.wikipedia.org/wiki/Wikipedia:Houptsyte Alemannic Wikipedia]. As contributor of a small wikipedia in a regional language, I’m interested in discussing problems of minority languages and dialects with users of other wikipedias in minority languages, regional languages, and dialects. I'm also member of the [[:meta:Small Wiki Monitoring Team|Small Wiki Monitoring Team]]. Please contact me [https://als.wikipedia.org/wiki/Benutzer_Diskussion:Holder here]. 9tikx0qdink1m057lfrjmgsvohk3gw1 Gebruiker:Ralgis 2 2674 4927 2014-11-27T23:49:02Z Savh 636 Savh het bladsy [[Gebruiker:Ralgis]] na [[Gebruiker:Allan Aguilar]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Ralgis|Ralgis]]" to "[[Special:CentralAuth/Allan Aguilar|Allan Aguilar]]" 4927 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Allan Aguilar]] nk5ygcpmcgrutl4gv86dpoudoevbvtr Gebruikerbespreking:Ralgis 3 2675 4930 2014-11-27T23:49:03Z Savh 636 Savh het bladsy [[Gebruikerbespreking:Ralgis]] na [[Gebruikerbespreking:Allan Aguilar]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Ralgis|Ralgis]]" to "[[Special:CentralAuth/Allan Aguilar|Allan Aguilar]]" 4930 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Allan Aguilar]] dhejqz0zz4x2u61dta1zst1swlvw2c3 Gebruikerbespreking:Ah3kal 3 2677 4932 2014-11-30T04:16:20Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Ah3kal]]) 4932 wikitext text/x-wiki Welcome to my page! please contact me at [[m:w:el:User talk:Ah3kal|User talk:Ah3kal @ el.wikipedia]] 67vgypbz2gxfpukcgcsc2b4x43eg8w1 Gebruiker:Alfasst 2 2679 4934 2014-11-30T09:28:09Z Alfasst 1471 Nuwe bladsy geskep met 'Once alfas was here --~~~~' 4934 wikitext text/x-wiki Once alfas was here --[[Gebruiker:Alfasst|Alfasst]] ([[Gebruikerbespreking:Alfasst|kontak]]) 09:28, 30 November 2014 (UTC) ca4wxtja3eu6nj3kkeqmd7953dtpi1z Gebruikerbespreking:Sam Sailor 3 2681 5178 4939 2015-12-12T22:18:19Z 5.103.59.108 Update 5178 wikitext text/x-wiki {| class="messagebox standard-talk" |- |style="text-align:center;"|[[Image:Imbox notice.png|left|40px]] |style="text-align:left;" width="100%"|Hi, and '''welcome''' to my talk page on {{SERVERNAME}}. Feel free to leave me a message here, but you ''will'' get a quicker response if you visit [[en:User talk:Sam Sailor|my user talk page on English Wikipedia]]. Thanks, Sam Sailor. |} aoenbxmelni5ddhcw2uhp40n9exxnn4 Gebruiker:Lestaty 2 2683 4948 2015-01-13T01:11:03Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Lestaty]]) 4948 wikitext text/x-wiki #REDIRECT [[User talk:Sir Lestaty de Lioncourt]] cc8rweyhovhvvro1gd6g7rh9zxi29el Gebruikerbespreking:Lestaty 3 2684 4949 2015-01-13T02:17:36Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Lestaty]]) 4949 wikitext text/x-wiki #REDIRECT [[User talk:Sir Lestaty de Lioncourt]] cc8rweyhovhvvro1gd6g7rh9zxi29el Gebruiker:Caliburn 2 2685 4987 4971 2015-02-20T11:33:22Z Billinghurst 870 Billinghurst het bladsy [[Gebruiker:George.Edward.C]] na [[Gebruiker:Caliburn]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/George.Edward.C|George.Edward.C]]" to "[[Special:CentralAuth/Caliburn|Caliburn]]" 4987 wikitext text/x-wiki __NOINDEX__[[File:Redirectltr.png]][[meta:User:George.Edward.C|Me @ Meta]] 0qt2melp40r0592gltncjamudoyvboh Gebruiker:*SM* 2 2687 4964 4961 2015-02-03T18:04:28Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:Suprememangaka]] na [[Gebruiker:*SM*]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Suprememangaka|Suprememangaka]]" to "[[Special:CentralAuth/*SM*|*SM*]]" 4964 wikitext text/x-wiki #AANSTUUR [[Gebruiker:*SM*]] l9zh5gap94eyn4h0bmjubkpkelzu9s1 Gebruikerbespreking:*SM* 3 2688 4966 4963 2015-02-03T18:04:28Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruikerbespreking:Suprememangaka]] na [[Gebruikerbespreking:*SM*]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Suprememangaka|Suprememangaka]]" to "[[Special:CentralA... 4966 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:*SM*]] sj2p2t8k1tbif2jelbvm96ws6v1mqkj Gebruiker:Suprememangaka 2 2689 4965 2015-02-03T18:04:28Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:Suprememangaka]] na [[Gebruiker:*SM*]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Suprememangaka|Suprememangaka]]" to "[[Special:CentralAuth/*SM*|*SM*]]" 4965 wikitext text/x-wiki #AANSTUUR [[Gebruiker:*SM*]] l9zh5gap94eyn4h0bmjubkpkelzu9s1 Gebruikerbespreking:Suprememangaka 3 2690 4967 2015-02-03T18:04:28Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruikerbespreking:Suprememangaka]] na [[Gebruikerbespreking:*SM*]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Suprememangaka|Suprememangaka]]" to "[[Special:CentralA... 4967 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:*SM*]] sj2p2t8k1tbif2jelbvm96ws6v1mqkj Gebruikerbespreking:Unapersona 3 2692 4970 2015-02-08T04:41:19Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Unapersona]]) 4970 wikitext text/x-wiki #REDIRECT[[m:User talk:Unapersona]] axmxwqgqn5cc3repvdpskh427rynpkh Gebruikerbespreking:Caliburn 3 2693 4989 4972 2015-02-20T11:33:22Z Billinghurst 870 Billinghurst het bladsy [[Gebruikerbespreking:George.Edward.C]] na [[Gebruikerbespreking:Caliburn]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/George.Edward.C|George.Edward.C]]" to "[[Special:CentralAuth/Caliburn|C... 4989 wikitext text/x-wiki <center><font face="Georgia">'''Hi there! Please do not contact me here. Instead, please contact me on [[meta:User_talk:George.Edward.C|meta]]. Messages left here may not get a timely response.</font></center> kv5wzoqoqwkaewjwmlncjbvwbbz9e5h Gebruikerbespreking:Mjbmr 3 2695 4980 2015-02-12T02:29:08Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Mjbmr]]) 4980 wikitext text/x-wiki __NOINDEX__<div dir="ltr">[[File:Redirect arrow without text.svg|46px|link=]][[w:en:User:Mjbmr|Mjbmr]]@Wikipedia ([[w:en:User talk:Mjbmr|Talk]]@Wikipedia)</div> iixdp9ugeyiqeurocghjgsb2lkrjjfm Gebruikerbespreking:Vanished user 24kwjf10h32h 3 2696 6680 5103 2020-06-05T13:19:22Z Sotiale 1034 Sotiale het bladsy [[Gebruikerbespreking:Diego Grez-Cañete]] na [[Gebruikerbespreking:Vanished user 24kwjf10h32h]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Diego Grez-Cañete|Diego Grez-Cañete]]" to "[[Special:CentralAuth/Vanished user 24kwjf10h32h|Vanished user 24kwjf10h32h]]" 5103 wikitext text/x-wiki __NOINDEX__ 4dk4zevx7zb4mh95uavtx21at6jgovp Gebruiker:George.Edward.C 2 2698 4988 2015-02-20T11:33:22Z Billinghurst 870 Billinghurst het bladsy [[Gebruiker:George.Edward.C]] na [[Gebruiker:Caliburn]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/George.Edward.C|George.Edward.C]]" to "[[Special:CentralAuth/Caliburn|Caliburn]]" 4988 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Caliburn]] o8ztbjdfhfy7jhj2lks7lau4mrbk910 Gebruikerbespreking:George.Edward.C 3 2699 4990 2015-02-20T11:33:22Z Billinghurst 870 Billinghurst het bladsy [[Gebruikerbespreking:George.Edward.C]] na [[Gebruikerbespreking:Caliburn]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/George.Edward.C|George.Edward.C]]" to "[[Special:CentralAuth/Caliburn|C... 4990 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Caliburn]] e5iiwwyi73zya6acqx2fsx9ewkir0cx Gebruiker:Vanished user 24kwjf10h32h 2 2700 6681 5101 2020-06-05T13:19:22Z Sotiale 1034 Sotiale het bladsy [[Gebruiker:Diego Grez-Cañete]] na [[Gebruiker:Vanished user 24kwjf10h32h]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Diego Grez-Cañete|Diego Grez-Cañete]]" to "[[Special:CentralAuth/Vanished user 24kwjf10h32h|Vanished user 24kwjf10h32h]]" 5101 wikitext text/x-wiki __NOINDEX__ 4dk4zevx7zb4mh95uavtx21at6jgovp Gebruiker:Küñall 2 2701 7170 5105 2022-02-21T00:16:39Z EmausBot 1982 Robot: kapotte doorverwijzing gecorrigeerd door aanpassing naar hernoemde doelpagina [[Gebruiker:Vanished user 24kwjf10h32h]] 7170 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Vanished user 24kwjf10h32h]] 1om8e5e9qnl9h8ht4pu0zc6i3th7rmx Gebruikerbespreking:Airridi~afwikibooks 3 2702 5049 5026 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5049 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Airridi. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Airridi~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:12, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> bk6h16em8ct3lj7sljp7j9fuzu3d17d Gebruikerbespreking:Akbar~afwikibooks 3 2703 5050 5027 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5050 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Akbar. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Akbar~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:12, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> ispyi0b1et5lo6ily9entezb131se0q Gebruikerbespreking:Alta~afwikibooks 3 2704 5051 5025 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5051 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Alta. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Alta~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:12, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> hgf4drb4us0d4dwvcfv0q7aljqpf5iz Gebruikerbespreking:Corneel~afwikibooks 3 2705 5052 5022 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5052 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Corneel. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Corneel~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:12, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> gf6245siv0sudmhs3kmcimu1r59l552 Gebruikerbespreking:Crusader~afwikibooks 3 2706 5054 5029 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5054 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Crusader. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Crusader~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 9mq2gsg6cuos03tglisetl7z96b6tss Gebruikerbespreking:Divan~afwikibooks 3 2707 5053 5021 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5053 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Divan. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Divan~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 47vix98uggwkppz3idja3t5lvoyl1lm Gebruikerbespreking:Gerhard~afwikibooks 3 2708 5055 5032 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5055 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Gerhard. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Gerhard~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 5pzxmcmytnvty9pyttevm9k9igficvp Gebruikerbespreking:Hendrik~afwikibooks 3 2709 5058 5031 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5058 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Hendrik. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Hendrik~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> d68x33qmyz5icqy6trz7hyit3eemktb Gebruikerbespreking:Hoo MergeAccount Test~afwikibooks 3 2710 5057 5028 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5057 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Hoo MergeAccount Test. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Hoo MergeAccount Test~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> mk13341qgjtz0a71k0eovti18yl1tqv Gebruikerbespreking:Janter~afwikibooks 3 2711 5059 5034 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5059 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Janter. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Janter~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> gjifsa790tjjjrw5mg3dttxh1fgu9pd Gebruikerbespreking:Llull~afwikibooks 3 2712 5060 5035 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5060 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Llull. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Llull~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 11tmdkkd5o1q5z8huotamc24alao34e Gebruikerbespreking:Marinda~afwikibooks 3 2713 5061 5043 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5061 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Marinda. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Marinda~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 81kadzimv8owb2pj7rslwjolhwh2r86 Gebruikerbespreking:MediaWiki default 3 2714 5007 2015-03-17T18:13:22Z MediaWiki message delivery 1367 Your account will be renamed 5007 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called MediaWiki default. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name MediaWiki default~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> 2oe6ib1vw1pajvnpi8g3f7shzdxqshu Gebruikerbespreking:MediaWiki spam cleanup 3 2715 5008 2015-03-17T18:13:23Z MediaWiki message delivery 1367 Your account will be renamed 5008 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called MediaWiki spam cleanup. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name MediaWiki spam cleanup~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> 09icl7w80wjlh912i076j2qjyw81zz2 Gebruikerbespreking:Natania~afwikibooks 3 2716 5064 5042 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5064 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Natania. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Natania~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 5433vjwe8v1i39o62buqcscz8b7fwte Gebruikerbespreking:Patio~afwikibooks 3 2717 5062 5037 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5062 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Patio. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Patio~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> i7y0gqv8pyodyh3awnnncbh9gnxaari Gebruikerbespreking:Rachel~afwikibooks 3 2718 5063 5038 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5063 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Rachel. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Rachel~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 38wx37tysgrcvttldiq0eu6t69ourj4 Gebruikerbespreking:Rift~afwikibooks 3 2719 5066 5036 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5066 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Rift. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Rift~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> spfsyv24a3b0epxrc7ox1ztt3zx7l1l Gebruikerbespreking:SaneSerenity~afwikibooks 3 2720 5065 5039 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5065 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called SaneSerenity. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name SaneSerenity~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 5pj4j3z3zl8jjugn3ff3lxn5q4pltn2 Gebruikerbespreking:Spam cleanup script~afwikibooks 3 2721 5067 5047 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5067 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Spam cleanup script. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Spam cleanup script~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> 20m0rguewq5fvznk27niz96ptw7hxhy Gebruikerbespreking:Stephan~afwikibooks 3 2722 5072 5046 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5072 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Stephan. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Stephan~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> e8f0apt6pqs1428jlhtwr39d4mk4njb Gebruikerbespreking:Susi~afwikibooks 3 2723 5070 5048 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5070 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Susi. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Susi~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> e3chaih9dfwadaltd6zlwpff5athv1y Gebruikerbespreking:Tehut~afwikibooks 3 2724 5069 5044 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5069 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Tehut. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Tehut~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> a353y6sbg51l566z2b85nhyzb86c9b6 Gebruikerbespreking:Whiteman~afwikibooks 3 2725 5071 5045 2015-04-16T16:09:02Z MediaWiki message delivery 1367 Renamed 5071 wikitext text/x-wiki == Your account will be renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr"> Hello, The developer team at Wikimedia is making some changes to how accounts work, as part of our on-going efforts to provide new and better tools for our users like cross-wiki notifications. These changes will mean you have the same account name everywhere. This will let us give you new features that will help you edit and discuss better, and allow more flexible user permissions for tools. One of the side-effects of this is that user accounts will now have to be unique across all 900 Wikimedia wikis. See [[m:Special:MyLanguage/Single User Login finalisation announcement|the announcement]] for more information. Unfortunately, your account clashes with another account also called Whiteman. To make sure that both of you can use all Wikimedia projects in future, we have reserved the name Whiteman~afwikibooks that only you will have. If you like it, you don't have to do anything. If you do not like it, you can [[Special:GlobalRenameRequest|pick out a different name]]. Your account will still work as before, and you will be credited for all your edits made so far, but you will have to use the new account name when you log in. Sorry for the inconvenience. Yours,<br />[[m:User:Keegan (WMF)|Keegan Peterzell]]<br />Community Liaison, Wikimedia Foundation </div> </div> 18:13, 17 Maart 2015 (UTC) <!-- SUL finalisation notification --> == Renamed == <div class="plainlinks mw-content-ltr" lang="en" dir="ltr”> This account has been renamed as part of [[m:Special:MyLanguage/Single User Login finalisation announcement|single-user login finalisation]]. If you own this account you can [[{{#special:userlogin}}|log in using your previous username and password]] for more information. If you do not like this account's new name, you can choose your own using this form after logging in: [[{{#special:GlobalRenameRequest}}]]. -- [[m:User:Keegan (WMF)|Keegan (WMF)]] ([[m:User talk:Keegan (WMF)|talk]]) </div> 16:09, 16 April 2015 (UTC) <!-- SUL post-rename notification --> ierc0f25wewqv4skw7cmxydxy1ypd88 Gebruikerbespreking:Sevela.p 3 2726 5020 2015-03-18T01:21:38Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Sevela.p]]) 5020 wikitext text/x-wiki __NOINDEX__[[File:Redirect arrow without text.svg|45px|link=]][[w:cs:User talk:Sevela.p|Sevela.p (cs.wikipedia.org)]] 7210kk8bqhstp21n3p3mihytpu2dcan Gebruiker:Azariv 2 2727 5074 2015-04-16T19:19:50Z Jalexander-WMF 586 Jalexander-WMF het bladsy [[Gebruiker:Azariv]] na [[Gebruiker:Azariv-WMF]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Azariv|Azariv]]" to "[[Special:CentralAuth/Azariv-WMF|Azariv-WMF]]" 5074 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Azariv-WMF]] pj0q7ktis5fyctydi5j3qxl8opwpdki Sjabloon:Knop 10 2728 5082 5081 2015-06-26T17:03:15Z Jcwf 638 5082 wikitext text/x-wiki <includeonly>[[image:{{{alt|nl-{{{1|}}}}}}.{{#if: {{{altogg|}}}|{{{altogg}}}|ogg}}|20px|noicon|left]]</includeonly><noinclude> This template is a shortcut to put audio files on a pages with only a small arrow button. E.g. <nowiki>{{knop|aap}}</nowiki> gives {{knop|aap}} ;Parameters :'''1''' the word contained in the nl-''word''.ogg name :'''alt-ogg''' if the ending is something else than ''ogg'' :'''alt''' to suppress the nl-prefix; give real name The template is used for the project '''[[Nederlands]]''' [[Category:Nederlands/Sjablone|{{PAGENAME}}]]</noinclude> p1dkjs3we4j2nmufoyoicxlq3yd804u Kategorie:Nederlands 14 2729 5086 2015-06-26T17:25:22Z Jcwf 638 Nuwe bladsy geskep met '[[Kategorie:Nederlands]]' 5086 wikitext text/x-wiki [[Kategorie:Nederlands]] 0yrz2bqxbj6rsspf1c589sudp27owzq Nederlands/Les 2 0 2730 5096 5095 2015-06-26T22:58:09Z Jcwf 638 5096 wikitext text/x-wiki ==Vriende wat gesels== {{Nederlands/Textbox| [[Image:Dutch_Lesson1_vrienden.OGG|40px|noicon]] ;{{C|Vrienden|Friends}} :Jan {{C|komt|kom}} Karel op straat {{C|tegen|teen}}. {{C|Ze|hulle}} {{C|zijn|is}} {{C|vrienden|vriende}}. ::''Jan'': {{C|Hoi|Hi}}, Karel! Hoe {{C|gaat|gaan}} {{C|het|dit}} {{C|met|with}} {{C|je|jou}}? :::''Karel'': Hoi! {{C|Dank je|Dankie}}, met {{C|mij|my}} gaat het goed. En met jou? ::''Jan'': Dank je, met mij gaat het ook goed. '''''{{C|Tot ziens|Tot siens}}'''''. :::''Karel'': Tot ziens, Jan! }} {|class="wikitable collapsible collapsed" style="float:right" |- !colspan="3"|Vocabulary |- !Word!!Audio!!Meaning |- |{{Nlwikt|tegenkomen}}||[[file:nl-tegenkomen.ogg]]||teenkom, ontmoet |- |de {{Nlwikt|straat}}||[[file:nl-straat.ogg]]||straat |- |{{Nlwikt|ze}}||[[file:nl-ze.ogg]]||hulle; sy |- |{{Nlwikt|zijn}}||[[file:nl-zijn.ogg]]||wees |- |{{Nlwikt|hoe}}||[[file:nl-hoe.ogg]]||hoe |- |{{Nlwikt|gaat}}||[[file:nl-gaat.ogg]]||gaan |- |{{Nlwikt|met}}||[[file:nl-met.ogg]]||met |- |{{Nlwikt|mij}}||[[file:nl-mij.ogg]]||my |- |{{Nlwikt|jou}}||[[file:nl-jou.ogg]]||jou |- |{{Nlwikt|dank}}||[[file:nl-dank.ogg]]||dank |- |{{Nlwikt|goed}}||[[file:nl-goed.ogg]]||goed |} [[File:Dutch people speaking on the street.jpg|thumb|200px|{{knop|vrienden}} Vrienden]] <br clear="all"> <!-- {{Dutch/Translation|Gesprek 1-1| ::Friends :::John runs into Charles in the street. They are friends. :::''John'': Hello Charles. How are you? :::''Charles'': Hi, thank you, I'm fine. And you? :::''John'': Thank you, I'm doing fine as well. Goodbye. :::''Charles'': Goodbye John! }} --> ===Uitspraak=== Die uitspraak van Nederlands varieer van plek tot plek en van spreker tot spreken. Die spelling is nie rêrig foneties nie, maar sistematies genoeg. Dis nie eenvoudig die klanke op te skryf, maar hier is 'n poging dit in IPA te doen. Try running the sound file again while reading the IPA version. :{{IPA|'vrin.də(n)}} :{{IPA|'jɑn.kɔmt.'ka.rəl.ɔp.'stra.'te.ɣə(n) zə.zɛɪn.vrin.də(n)}} ::{{IPA|ɦɔj,'ka.rəl.ɦu.'ɣat.ət.'mɛ.cə}} ::{{IPA|ɦɔj,dɑŋ.k<sup>j</sup>ə,mɛt.'mɛɪ.'ɣat.ət.xut.ʔɛn.'mɛ.'cɑʊ}} ::{{IPA|dɑŋ.k<sup>j</sup>ə,mɛt.mɛɪ.'ɣat.ət.'ok.xut. tɔ.'tsins}} ::{{IPA|tɔ.'tsins.jɑn}} <!-- :Notice sounds like {{IPA|[ɣ]}} and {{IPA|[x]}}? And how t+j run together into {{IPA|[c]}}? And how about {{IPA|[ɦ]}}? Or the vowel {{IPA|[u]}}? :Notice also that vowels often occur in two varieties: {{IPA|a/ɑ, e/ɛ, o/ɔ}}. They are often called 'long' and 'short', but those names are misleading: they are really different sounding vowels.<ref>This is particularly a point of difficulty for speakers of Slavic languages like Russian or Czech.</ref> The length difference is rather secondary, if there is any. --> qutjnckqugfcmigk7mkhkiwdfcwxcy4 Sjabloon:Nederlands/Textbox 10 2731 5089 2015-06-26T17:37:53Z Jcwf 638 Nuwe bladsy geskep met '{| align=left cellspacing=10 class=PrettyTextBox style="background-color: #FCF8E6; -moz-border-radius: 1em; margin-bottom: 1em; width: 50%;" | {{{1|}}} |}' 5089 wikitext text/x-wiki {| align=left cellspacing=10 class=PrettyTextBox style="background-color: #FCF8E6; -moz-border-radius: 1em; margin-bottom: 1em; width: 50%;" | {{{1|}}} |} 1xvu987d5id24nt2271qlqwc72lkgok Sjabloon:Nlwikt 10 2732 5090 2015-06-26T17:40:31Z Jcwf 638 Nuwe bladsy geskep met '[[:nl:wikt:{{{2|{{{1}}}}}}|{{{1}}}]]<noinclude>[[Category:Nederlands/Sjablone|{{PAGENAME}}]]</noinclude>' 5090 wikitext text/x-wiki [[:nl:wikt:{{{2|{{{1}}}}}}|{{{1}}}]]<noinclude>[[Category:Nederlands/Sjablone|{{PAGENAME}}]]</noinclude> 4n68mvnb0atvz7ko244hgfwasdvmbu8 Sjabloon:C 10 2733 5091 2015-06-26T18:17:29Z Jcwf 638 Nuwe bladsy geskep met '<includeonly><span title="{{#if:{{{3|}}}|{{{2}}} = {{{3}}}|{{{1}}} = {{{2}}}}}" style="border-bottom:1px dotted">{{{1}}}</span></includeonly><noinclude>This template crea...' 5091 wikitext text/x-wiki <includeonly><span title="{{#if:{{{3|}}}|{{{2}}} = {{{3}}}|{{{1}}} = {{{2}}}}}" style="border-bottom:1px dotted">{{{1}}}</span></includeonly><noinclude>This template creates tooltips, i. e. small texts that show up when the mouse cursor hovers over a piece of text. This template takes two or three parameters, making it flexible in dealing with word-by-word translations as well as more general translations that also provide the basic form of the translated term. In the case of two parameters, the syntax is as follows: <nowiki>{{C|Wörter|words}}</nowiki> yielding the following output: :{{C|Wörter|words}} "Wörter" is the text the reader will see. The tooltip provides the text "Wörter = words". In the case of three parameters, the syntax is as follows: <nowiki>{{C|Wörter|das Wort|word}}</nowiki> yielding the output: :{{C|Wörter|das Wort|word}} Here, the tooltip provides the text "das Wort = words", that is it does not repeat the original text but shows a different one. [[Category:Nederlands/Sjablone|{{PAGENAME}}]]</noinclude> hjvy5hoz8y1bnj4p9tjeihc96mmthll Sjabloon:IPA 10 2734 5094 2015-06-26T22:55:41Z Jcwf 638 Nuwe bladsy geskep met '<span class="IPA" title="This is an IPA-transcription; see: International phonetic alphabet." style="white-space: nowrap; font-family: Gentium, Charis SIL, Code2000, Luci...' 5094 wikitext text/x-wiki <span class="IPA" title="This is an IPA-transcription; see: International phonetic alphabet." style="white-space: nowrap; font-family: Gentium, Charis SIL, Code2000, Lucida Sans Unicode, TITUS Cyberbit Basic, Arial Unicode MS, Lucida Grande, DejaVu Sans;">{{{1}}}</span><noinclude> [[Category:Tekssjablone|{{PAGENAME}}]] </noinclude> qwnr5turnlga5tmnol96ksfa20lkym0 Gebruiker:Diego Grez 2 2735 7169 5102 2022-02-21T00:16:29Z EmausBot 1982 Robot: kapotte doorverwijzing gecorrigeerd door aanpassing naar hernoemde doelpagina [[Gebruiker:Vanished user 24kwjf10h32h]] 7169 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Vanished user 24kwjf10h32h]] 1om8e5e9qnl9h8ht4pu0zc6i3th7rmx Gebruikerbespreking:Diego Grez 3 2736 7172 5104 2022-02-21T00:16:59Z EmausBot 1982 Robot: kapotte doorverwijzing gecorrigeerd door aanpassing naar hernoemde doelpagina [[Gebruikerbespreking:Vanished user 24kwjf10h32h]] 7172 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Vanished user 24kwjf10h32h]] l60dd8xab81pi46151rsfr84x9e8xqo Sjabloon:FlowMention 10 2737 5107 2015-08-03T23:29:08Z Flow talk page manager 1613 /* Automatically created by Flow */ 5107 wikitext text/x-wiki @[[Gebruiker:{{{1|Example}}}|{{{2|{{{1|Example}}}}}}]] qxb2vi0hruu5m5r2f6j1xz9vt2ssidm Gebruikerbespreking:בײַ מיר ביסטו שיין 3 2738 5160 5142 2015-09-23T12:17:40Z בײַ מיר ביסטו שיין 1619 layout: 2015-09-17…b LTR RTL short bmbsh 5160 wikitext text/x-wiki {| class="float-center" border="0" cellpadding="0" cellspacing="0" style="background:#efefef; color:black" align="center" LANG="en" |- | align="center" colspan="2" | <!-- <span dir="ltr" >The phonetic transcription of <span class="nowrap" >«&nbsp;לערי&nbsp;ריינהארט&nbsp;»</span> is <span class="nowrap" LANG="he" >/lɛʁi&nbsp;ʁɑjnhɑʁt/</span> <span class="nowrap" >(leri&nbsp;raynhart).</span></span><br /> --> <span dir="ltr" >The phonetic transcription of <span class="nowrap" LANG="he" >«&nbsp;[[s:yi:בייַ מיר ביסטו שיין|בײַ&nbsp;מיר&nbsp;ביסטו&nbsp;שיין]]&nbsp;»</span> is <span class="nowrap" >/bɑj&nbsp;mɪʁ&nbsp;bɪstu&nbsp;ʃɛyn/</span> <span class="nowrap" >([[w:en:Bei Mir Bistu Shein|bay&nbsp;mir&nbsp;bistu&nbsp;sheyn]]).</span><br />&nbsp;</span><br /> {{Softredirect|1=testwiki:user talk:{{PAGENAME}}|2=<span dir="ltr" >testwiki:user talk:<span dir="ltr" >{{PAGENAME}}</span></span>}} <!-- |- | align="right" | [[image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:Gangleri]] --> |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' |}<!-- |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:Gangleri]] |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' --> <br clear="all" /> <!-- **only at sandbox subpages** <center dir="ltr" >This page is an '''user sandbox page'''.<br />'''SUBPAGENAME''':&nbsp;'''{{SUBPAGENAME}}'''&nbsp;&ndash; '''[[mediawiki:Sandbox]]''':&nbsp;'''{{int:Sandbox}}'''&nbsp;<sup>[[w:en:mediawiki:Sandbox]]</sup></center> ---- --> <center> : <sup><span dir="ltr" class="plainlinks" >SITENAME: '''{{SITENAME}}'''&nbsp;· '''language:'''&nbsp;{{CONTENTLANG}}:&nbsp;'''[{{fullurl:{{FULLPAGENAME}}|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:{{FULLPAGENAME}}|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}}}#footer #footer]</span></sup><!-- special:version --> : <sup><span dir "ltr" class="plainlinks" >[[special:version|local curent version]]: {{CURRENTVERSION}}&nbsp;· versions&nbsp;at&nbsp;[[b:special:version|b:]]&nbsp;· [[c:special:version|c:]]&nbsp;· [[d:special:version|d:]]&nbsp;·&nbsp;[[testwikidata:special:version|d2:]]&nbsp;· '''[[m:special:version|m:]]'''&nbsp;· [[mw:special:version|mw:]]&nbsp;· [[n:special:version|n:]]&nbsp;· [[q:special:version|q:]]&nbsp;· [[s:special:version|s:]]&nbsp;· '''[[testwiki:special:version|t:]]'''&nbsp;·&nbsp;[[test2wiki:special:version|t2:]]&nbsp;· [[v:special:version|v:]]&nbsp;· [[voy:special:version|voy:]]&nbsp;· [[w:special:version|w:]]&nbsp;· [[wikt:special:version|wikt:]]&nbsp;· [[w:en:special:version|w:en:]]&nbsp;· [[m:special:sitematrix#{{CONTENTLANG}}|m:special:sitematrix#{{CONTENTLANG}}]]&nbsp;· [[template:Wikivar]]&nbsp;·&nbsp;<sup>[[m:template:Wikivar|m:]]&lrm;</sup></span></sup> : <sup><span dir="ltr" class="plainlinks" >'''mediawiki:Sidebar'''&nbsp;'''[{{fullurl:mediawiki:Sidebar|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:mediawiki:Sidebar/en|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:mediawiki:Sidebar/de|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/es|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/fr|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/it|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ru|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/zh|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ar|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/he|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/hi|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/eo|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]</span></sup> : <sup><span dir "ltr" class="plainlinks" >[{{fullurl:special:Preferences}}#top <span dir="ltr" LANG="en" >your]&nbsp;[{{fullurl:special:Preferences|uselang=en}}#top <span dir="ltr" LANG="en" >local preferences]&nbsp;· [{{fullurl:special:Preferences|uselang=de}}#mw-prefsection-personal <span dir="ltr" LANG="de" >Einstellungen</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=es}}#mw-prefsection-rendering <span dir="ltr" LANG="es" >Preferencias</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=fr}}#mw-prefsection-editing <span dir="ltr" LANG="fr" >Préférences</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=it}}#mw-prefsection-rc <span dir="ltr" LANG="it" >Preferenze</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ru}}#mw-prefsection-watchlist <span dir="ltr" LANG="ru" >Настройки</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=zh}}#mw-prefsection-gadgets <span dir="ltr" LANG="zh" >设置</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ar}}#mw-prefsection-betafeatures <span dir="ltr" LANG="ar" >تفضيلات</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=he}}#mw-prefsection-betafeatures <span dir="ltr" LANG="he" >העדפות</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=hi}}#top <span dir="ltr" LANG="hi" >मेरी वरीयताएँ</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=eo}}#top <span dir="ltr" LANG="eo" >Preferoj</span>]</span></sup><!-- user:{{BASEPAGENAME}} --> : <sup><span dir "ltr" class="plainlinks" >user&nbsp;/&nbsp;&lrm;'''<span dir="ltr" >{{ns:2}}</span>'''&lrm;:&nbsp;&lrm;'''<span dir="ltr" >[[user:{{BASEPAGENAME}}|{{BASEPAGENAME}}]]</span>&lrm;'''&nbsp;·&nbsp;[{{SERVER}}/?title=special:ListUsers&limit=1&username={{BASEPAGENAMEE}} rights]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}|all subpages]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}|T]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.css|&lrm;/common.css]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.js|/common.js]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/Archive/previous user page|/previous user page]]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}/Archive|archives]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}/Archive|archived talks]]&nbsp;· [[b:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|b:]]&nbsp;· [[c:user:{{BASEPAGENAME}}|c:]]&nbsp;· [[d:user:{{BASEPAGENAME}}|d:]]&nbsp;·&nbsp;[[testwikidata:user:{{BASEPAGENAME}}|d2:]]&nbsp;· [[m:user:{{BASEPAGENAME}}|m:]]&nbsp;· [[mw:user:{{BASEPAGENAME}}|mw:]]&nbsp;· [[n:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|n:]]&nbsp;· [[q:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|q:]]&nbsp;· [[s:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|s:]]&nbsp;· [[testwiki:user:{{BASEPAGENAME}}|t:]]&nbsp;·&nbsp;[[test2wiki:user:{{BASEPAGENAME}}|t2:]]&nbsp;· [[v:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|v:]]&nbsp;· [[voy:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|voy:]]&nbsp;· [[w:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|w:]]&nbsp;· [[wikt:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|wikt:]]&nbsp;· [[w:en:user:{{BASEPAGENAME}}|w:en:]]&nbsp;·&nbsp;[[w:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[:en:user:{{BASEPAGENAME}}|:en:]]&lrm;</span></sup><!-- special:foobar --> : <sup><span dir "ltr" class="plainlinks" >&nbsp;[{{fullurl:special:WhatLinksHere/{{FULLPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;WLH]&lrm;&nbsp;· [{{fullurl:special:RecentChanges|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;RC]&lrm;&nbsp;· [{{fullurl:special:Logs|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;logs]&lrm;&nbsp;· [{{fullurl:special:WatchList|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;watchlist]&lrm;&nbsp;<sup>[{{fullurl:special:WatchList/edit|uselang=en}}#top <span LANG="en" >&nbsp;edit]</sup>&lrm;&nbsp;· [{{fullurl:special:Contributions/{{BASEPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;ontributions]&lrm;&nbsp;· [[mediawiki:Common.css|'''local'''&nbsp;mediawiki:Common.css]]&nbsp;· [[mediawiki:Common.js|'''local'''&nbsp;mediawiki:Common.js]]&nbsp;· [[mediawiki:Gadgets-definition|'''local'''&nbsp;mediawiki:Gadgets-definition]]&nbsp;· '''[[special:Notifications|local notifications]]'''<br />[[m:user:{{BASEPAGENAME}}/global.css|m:…'''/global.css''']]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}/global.js|m:…'''/global.js''']]&nbsp;·&nbsp;[[special:centralAuth/{{BASEPAGENAMEE}}|'''global'''&nbsp;account&nbsp;information]]&nbsp;· [https://tools.wmflabs.org/guc/?user={{URLENCODE:{{BASEPAGENAME}}|WIKI}} '''global'''&nbsp;user&nbsp;contributions]<!-- &nbsp;· [https://toolserver.org/~River/cgi-bin/count_edits?user={{BASEPAGENAMEE}}&dbname=wikidatawiki_p&machread=1] --></span></sup><!-- PAGEID related links --> : <sup><span dir "ltr" class="plainlinks" >'''PAGEID:'''&nbsp;{{PAGEID}}&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}#top links&nbsp;'''here''']&nbsp;· <sup>[https:{{SERVER}}/?curid={{PAGEID}}&action=purge# purge&nbsp;↺]&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}&action=edit&section=0# section=0]</sup>&nbsp;· '''REVISIONID:'''&nbsp;{{REVISIONID}}&nbsp;· [https:{{SERVER}}/?oldid={{REVISIONID}}# permanent&nbsp;link]&nbsp;· (layout:&nbsp;2015-09-17…b&nbsp;[https://fi.wikipedia.org/?curid=468081#top LTR]&nbsp;[https://ug.wiktionary.org/?curid=5716#top RTL]&nbsp;short)&lrm;</span></sup><!-- testing and validation links related languages / dialects --> : <sup><span dir "ltr" class="plainlinks" >'''testing and validation links:'''&nbsp;[[user:בײַ מיר ביסטו שיין#BiDi_issues|BiDi issues]]&nbsp;· [[user:I18n|gadget issues]]&nbsp;· '''[[#related languages]] / [[#related dialects]]'''&nbsp;· [[/local notes]]</span></sup> </center> ---- <!-- <br clear="all" /> --> __TOC__ == <span dir="ltr" >Welcome&lrm;&nbsp;<span id="Welcome" dir="ltr" >{{PAGENAME}}</span>&nbsp;to&nbsp;<span id="WelcomeToSITENAME" dir="ltr" >{{SITENAME}}</span>!</span> == <!-- layout: 2015-09-17…b LTR RTL short bmbsh --> : [[Gebruiker:בײַ מיר ביסטו שיין|בײַ מיר ביסטו שיין]] ([[Gebruikerbespreking:בײַ מיר ביסטו שיין|kontak]]) 12:17, 23 September 2015 (UTC) === related languages === : Finnish Wikipedia ([[d:Q175482|Q175482]]) : Finnish language ([[d:Q1412|Q1412]]) <!-- == <span dir="ltr" >Welcome!</span> == → [[template:Welcome]] {{welcome}} --> == <span dir="ltr" >Welcome!</span> == → [[template:Welcome]] nah86ocibq16m2pp5cjxtwy34km4pzl Gebruikerbespreking:לערי ריינהארט 3 2739 5140 5123 2015-09-08T22:17:26Z לערי ריינהארט 1620 layout:&nbsp;2015-09-07…d&nbsp;LTR&nbsp;RTL leri 5140 wikitext text/x-wiki {| class="float-center" border="0" cellpadding="0" cellspacing="0" style="background:#efefef; color:black" align="center" LANG="en" |- | align="center" colspan="2" | <span dir="ltr" >The phonetic transcription of <span class="nowrap" >«&nbsp;לערי&nbsp;ריינהארט&nbsp;»</span> is <span class="nowrap" LANG="he" >/lɛʁi&nbsp;ʁɑjnhɑʁt/</span> <span class="nowrap" >(leri&nbsp;raynhart).</span></span><br /> <!-- <span dir="ltr" >The phonetic transcription of <span class="nowrap" LANG="he" >«&nbsp;[[s:yi:בייַ מיר ביסטו שיין|בײַ&nbsp;מיר&nbsp;ביסטו&nbsp;שיין]]&nbsp;»</span> is <span class="nowrap" >/bɑj&nbsp;mɪʁ&nbsp;bɪstu&nbsp;ʃɛyn/</span> <span class="nowrap" >([[w:en:Bei Mir Bistu Shein|bay&nbsp;mir&nbsp;bistu&nbsp;sheyn]]).</span><br />&nbsp;</span><br /> --> {{Softredirect|1=testwiki:user talk:{{PAGENAME}}|2=<span dir="ltr" >testwiki:user talk:<span dir="ltr" >{{PAGENAME}}</span></span>}} |- | align="right" | [[image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:Gangleri]] |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' |}<!-- |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:Gangleri]] |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' --> <br clear="all" /> <!-- **only at sandbox subpages** <center dir="ltr" >This page is an '''user sandbox page'''.<br />'''SUBPAGENAME''':&nbsp;'''{{SUBPAGENAME}}'''&nbsp;&ndash; '''[[mediawiki:Sandbox]]''':&nbsp;'''{{int:Sandbox}}'''&nbsp;<sup>[[w:en:mediawiki:Sandbox]]</sup></center> ---- --> <center> : <sup><span dir="ltr" class="plainlinks" >SITENAME: '''{{SITENAME}}'''&nbsp;· '''language:'''&nbsp;{{CONTENTLANG}}:&nbsp;'''[{{fullurl:{{FULLPAGENAME}}|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:{{FULLPAGENAME}}|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}}}#footer #footer]</span></sup><!-- special:version --> : <sup><span dir "ltr" class="plainlinks" >[[special:version|local curent version]]: {{CURRENTVERSION}}&nbsp;· versions&nbsp;at&nbsp;[[b:special:version|b:]]&nbsp;·&nbsp;[[c:special:version|c:]]&nbsp;·&nbsp;[[d:special:version|d:]]&nbsp;·&nbsp;'''[[m:special:version|m:]]'''&nbsp;·&nbsp;[[mw:special:version|mw:]]&nbsp;·&nbsp;[[n:special:version|n:]]&nbsp;·&nbsp;[[q:special:version|q:]]&nbsp;·&nbsp;[[s:special:version|s:]]&nbsp;·&nbsp;'''[[testwiki:special:version|t:]]'''&nbsp;·&nbsp;[[v:special:version|v:]]&nbsp;·&nbsp;[[voy:special:version|voy:]]&nbsp;·&nbsp;[[w:special:version|w:]]&nbsp;·&nbsp;[[wikt:special:version|wikt:]]&nbsp;·&nbsp;[[w:en:special:version|w:en:]]&nbsp;·&nbsp;[[m:special:sitematrix#{{CONTENTLANG}}|m:special:sitematrix#{{CONTENTLANG}}]]&nbsp;·&nbsp;[[template:Wikivar]]&nbsp;·&nbsp;<sup>[[m:template:Wikivar|m:]]&lrm;</sup></span></sup> : <sup><span dir="ltr" class="plainlinks" >'''mediawiki:Sidebar'''&nbsp;'''[{{fullurl:mediawiki:Sidebar|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:mediawiki:Sidebar/en|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:mediawiki:Sidebar/de|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/es|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/fr|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/it|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ru|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/zh|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ar|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/he|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/hi|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/eo|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]</span></sup> : <sup><span dir "ltr" class="plainlinks" >[{{fullurl:special:Preferences}}#top <span dir="ltr" LANG="en" >your]&nbsp;[{{fullurl:special:Preferences|uselang=en}}#top <span dir="ltr" LANG="en" >local preferences]&nbsp;· [{{fullurl:special:Preferences|uselang=de}}#mw-prefsection-personal <span dir="ltr" LANG="de" >Einstellungen</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=es}}#mw-prefsection-rendering <span dir="ltr" LANG="es" >Preferencias</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=fr}}#mw-prefsection-editing <span dir="ltr" LANG="fr" >Préférences</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=it}}#mw-prefsection-rc <span dir="ltr" LANG="it" >Preferenze</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ru}}#mw-prefsection-watchlist <span dir="ltr" LANG="ru" >Настройки</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=zh}}#mw-prefsection-gadgets <span dir="ltr" LANG="zh" >设置</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ar}}#mw-prefsection-betafeatures <span dir="ltr" LANG="ar" >تفضيلات</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=he}}#mw-prefsection-betafeatures <span dir="ltr" LANG="he" >העדפות</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=hi}}#top <span dir="ltr" LANG="hi" >मेरी वरीयताएँ</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=eo}}#top <span dir="ltr" LANG="eo" >Preferoj</span>]</span></sup><!-- user:{{BASEPAGENAME}} --> : <sup><span dir "ltr" class="plainlinks" >user&nbsp;/&nbsp;&lrm;'''<span dir="ltr" >{{ns:2}}</span>'''&lrm;:&nbsp;&lrm;'''<span dir="ltr" >[[user:{{BASEPAGENAME}}|{{BASEPAGENAME}}]]</span>&lrm;'''&nbsp;·&nbsp;[{{SERVER}}/?title=special:ListUsers&limit=1&username={{BASEPAGENAMEE}} rights]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}|all subpages]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}|T]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.css|&lrm;/common.css]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.js|/common.js]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/Archive/previous user page|/previous user page]]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}/Archive|archives]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}/Archive|archived talks]]&nbsp;·&nbsp;[[b:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|b:]]&nbsp;·&nbsp;[[c:user:{{BASEPAGENAME}}|c:]]&nbsp;·&nbsp;[[d:user:{{BASEPAGENAME}}|d:]]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}|m:]]&nbsp;·&nbsp;[[mw:user:{{BASEPAGENAME}}|mw:]]&nbsp;·&nbsp;[[n:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|n:]]&nbsp;·&nbsp;[[q:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|q:]]&nbsp;·&nbsp;[[s:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|s:]]&nbsp;·&nbsp;[[testwiki:user:{{BASEPAGENAME}}|t:]]&nbsp;·&nbsp;[[v:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|v:]]&nbsp;·&nbsp;[[voy:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|voy:]]&nbsp;·&nbsp;[[w:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[wikt:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|wikt:]]&nbsp;·&nbsp;[[w:en:user:{{BASEPAGENAME}}|w:en:]]&nbsp;·&nbsp;[[w:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[:en:user:{{BASEPAGENAME}}|:en:]]&lrm;</span></sup><!-- special:foobar --> : <sup><span dir "ltr" class="plainlinks" >&nbsp;[{{fullurl:special:WhatLinksHere/{{FULLPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;WLH]&lrm;&nbsp;· [{{fullurl:special:RecentChanges|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;RC]&lrm;&nbsp;· [{{fullurl:special:Logs|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;logs]&lrm;&nbsp;· [{{fullurl:special:WatchList|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;watchlist]&lrm;&nbsp;· [{{fullurl:special:Contributions/{{BASEPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;ontributions]&lrm;&nbsp;· [[mediawiki:Common.css|'''local'''&nbsp;mediawiki:Common.css]]&nbsp;· [[mediawiki:Common.js|'''local'''&nbsp;mediawiki:Common.js]]&nbsp;· [[mediawiki:Gadgets-definition|'''local'''&nbsp;mediawiki:Gadgets-definition]]&nbsp;· '''[[special:Notifications|local notifications]]'''<br />[[m:user:{{BASEPAGENAME}}/global.css|m:…'''/global.css''']]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}/global.js|m:…'''/global.js''']]&nbsp;·&nbsp;[[special:centralAuth/{{BASEPAGENAMEE}}|'''global'''&nbsp;account&nbsp;information]]&nbsp;· [https://tools.wmflabs.org/guc/?user={{URLENCODE:{{BASEPAGENAME}}|WIKI}} '''global'''&nbsp;user&nbsp;contributions]<!-- &nbsp;· [https://toolserver.org/~River/cgi-bin/count_edits?user={{BASEPAGENAMEE}}&dbname=wikidatawiki_p&machread=1] --></span></sup><!-- PAGEID related links --> : <sup><span dir "ltr" class="plainlinks" >'''PAGEID:'''&nbsp;{{PAGEID}}&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}#top links&nbsp;'''here''']&nbsp;· <sup>[https:{{SERVER}}/?curid={{PAGEID}}&action=purge# purge&nbsp;↺]&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}&action=edit&section=0# section=0]</sup>&nbsp;· '''REVISIONID:'''&nbsp;{{REVISIONID}}&nbsp;· [https:{{SERVER}}/?oldid={{REVISIONID}}# permanent&nbsp;link]&nbsp;· (layout:&nbsp;2015-09-07…d&nbsp;[https://fi.wikipedia.org/?curid=468081#top LTR]&nbsp;[https://ug.wiktionary.org/?curid=5716#top RTL]&nbsp;short)&lrm;</span></sup><!-- testing and validation links related languages / dialects --> : <sup><span dir "ltr" class="plainlinks" >'''testing and validation links:'''&nbsp;[[user:בײַ מיר ביסטו שיין#BiDi_issues|BiDi issues]]&nbsp;· [[user:I18n|gadget issues]]&nbsp;· '''related languages / dialects:'''&nbsp;[[w:foo:user:{{BASEPAGENAME}}|w:foo:]]&nbsp;·&nbsp;[[w:bar:user:{{BASEPAGENAME}}|w:bar:]]&lrm;</span></sup> </center> ---- <!-- <br clear="all" /> --> __TOC__ == <span dir="ltr" >Welcome&lrm;&nbsp;<span id="Welcome" dir="ltr" >{{PAGENAME}}</span>&nbsp;to&nbsp;<span id="WelcomeToSITENAME" dir="ltr" >{{SITENAME}}</span>!</span> == : 23:45, 26 Augustus 2015 (UTC) : [[Gebruiker:לערי ריינהארט|לערי ריינהארט]] ([[Gebruikerbespreking:לערי ריינהארט|kontak]]) 22:17, 8 September 2015 (UTC) qeglyqyi9634w43a9gvz633yfk0tox3 Gebruikerbespreking:I18n 3 2740 5141 5125 2015-09-09T08:57:44Z I18n 1623 layout: 2015-09-07…d LTR RTL short 5141 wikitext text/x-wiki {| class="float-center" border="0" cellpadding="3" cellspacing="5" style="background:#efefef; color:black" align="center" LANG="en" |- | align="center" colspan="2" | <!-- <span dir="ltr" >The phonetic transcription of <span class="nowrap" >«&nbsp;לערי&nbsp;ריינהארט&nbsp;»</span> is <span class="nowrap" LANG="he" >/lɛʁi&nbsp;ʁɑjnhɑʁt/</span> <span class="nowrap" >(leri&nbsp;raynhart).</span></span><br /> <span dir="ltr" >The phonetic transcription of <span class="nowrap" LANG="he" >«&nbsp;[[s:yi:בייַ מיר ביסטו שיין|בײַ&nbsp;מיר&nbsp;ביסטו&nbsp;שיין]]&nbsp;»</span> is <span class="nowrap" >/bɑj&nbsp;mɪʁ&nbsp;bɪstu&nbsp;ʃɛyn/</span> <span class="nowrap" >([[w:en:Bei Mir Bistu Shein|bay&nbsp;mir&nbsp;bistu&nbsp;sheyn]]).</span><br />&nbsp;</span><br /> --> {{Softredirect|1=testwiki:user talk:{{PAGENAME}}|2=<span dir="ltr" >testwiki:user talk:<span dir="ltr" >{{PAGENAME}}</span></span>}} <!-- |- | align="right" | [[image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:Gangleri]] --> |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' |}<!-- |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:Gangleri]] |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] [[user talk:לערי ריינהארט]] aka "''Gangleri''" |- | align="center" colspan="2" dir="ltr" | [[image:Redirectltr.png|left]] '''[[testwiki:user talk:לערי ריינהארט]] aka "''Gangleri''"''' --> <br clear="all" /> <!-- **only at sandbox subpages** <center dir="ltr" >This page is an '''user sandbox page'''.<br />'''SUBPAGENAME''':&nbsp;'''{{SUBPAGENAME}}'''&nbsp;&ndash; '''[[mediawiki:Sandbox]]''':&nbsp;'''{{int:Sandbox}}'''&nbsp;<sup>[[w:en:mediawiki:Sandbox]]</sup></center> ---- --> <center> : <sup><span dir="ltr" class="plainlinks" >SITENAME: '''{{SITENAME}}'''&nbsp;· '''language:'''&nbsp;{{CONTENTLANG}}:&nbsp;'''[{{fullurl:{{FULLPAGENAME}}|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:{{FULLPAGENAME}}|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}}}#footer #footer]</span></sup><!-- special:version --> : <sup><span dir "ltr" class="plainlinks" >[[special:version|local curent version]]: {{CURRENTVERSION}}&nbsp;· versions&nbsp;at&nbsp;[[b:special:version|b:]]&nbsp;·&nbsp;[[c:special:version|c:]]&nbsp;·&nbsp;[[d:special:version|d:]]&nbsp;·&nbsp;'''[[m:special:version|m:]]'''&nbsp;·&nbsp;[[mw:special:version|mw:]]&nbsp;·&nbsp;[[n:special:version|n:]]&nbsp;·&nbsp;[[q:special:version|q:]]&nbsp;·&nbsp;[[s:special:version|s:]]&nbsp;·&nbsp;'''[[testwiki:special:version|t:]]'''&nbsp;·&nbsp;[[v:special:version|v:]]&nbsp;·&nbsp;[[voy:special:version|voy:]]&nbsp;·&nbsp;[[w:special:version|w:]]&nbsp;·&nbsp;[[wikt:special:version|wikt:]]&nbsp;·&nbsp;[[w:en:special:version|w:en:]]&nbsp;·&nbsp;[[m:special:sitematrix#{{CONTENTLANG}}|m:special:sitematrix#{{CONTENTLANG}}]]&nbsp;·&nbsp;[[template:Wikivar]]&nbsp;·&nbsp;<sup>[[m:template:Wikivar|m:]]&lrm;</sup></span></sup> : <sup><span dir="ltr" class="plainlinks" >'''mediawiki:Sidebar'''&nbsp;'''[{{fullurl:mediawiki:Sidebar|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:mediawiki:Sidebar/en|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:mediawiki:Sidebar/de|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/es|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/fr|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/it|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ru|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/zh|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/ar|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/he|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/hi|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:mediawiki:Sidebar/eo|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]</span></sup> : <sup><span dir "ltr" class="plainlinks" >[{{fullurl:special:Preferences}}#top <span dir="ltr" LANG="en" >your]&nbsp;[{{fullurl:special:Preferences|uselang=en}}#top <span dir="ltr" LANG="en" >local preferences]&nbsp;· [{{fullurl:special:Preferences|uselang=de}}#mw-prefsection-personal <span dir="ltr" LANG="de" >Einstellungen</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=es}}#mw-prefsection-rendering <span dir="ltr" LANG="es" >Preferencias</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=fr}}#mw-prefsection-editing <span dir="ltr" LANG="fr" >Préférences</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=it}}#mw-prefsection-rc <span dir="ltr" LANG="it" >Preferenze</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ru}}#mw-prefsection-watchlist <span dir="ltr" LANG="ru" >Настройки</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=zh}}#mw-prefsection-gadgets <span dir="ltr" LANG="zh" >设置</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=ar}}#mw-prefsection-betafeatures <span dir="ltr" LANG="ar" >تفضيلات</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=he}}#mw-prefsection-betafeatures <span dir="ltr" LANG="he" >העדפות</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=hi}}#top <span dir="ltr" LANG="hi" >मेरी वरीयताएँ</span>]&nbsp;· [{{fullurl:special:Preferences|uselang=eo}}#top <span dir="ltr" LANG="eo" >Preferoj</span>]</span></sup><!-- user:{{BASEPAGENAME}} --> : <sup><span dir "ltr" class="plainlinks" >user&nbsp;/&nbsp;&lrm;'''<span dir="ltr" >{{ns:2}}</span>'''&lrm;:&nbsp;&lrm;'''<span dir="ltr" >[[user:{{BASEPAGENAME}}|{{BASEPAGENAME}}]]</span>&lrm;'''&nbsp;·&nbsp;[{{SERVER}}/?title=special:ListUsers&limit=1&username={{BASEPAGENAMEE}} rights]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}|all subpages]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}|T]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.css|&lrm;/common.css]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/common.js|/common.js]]&nbsp;·&nbsp;[[user:{{BASEPAGENAME}}/Archive/previous user page|/previous user page]]&nbsp;·&nbsp;[[special:Prefixindex/user:{{BASEPAGENAME}}/Archive|archives]]&nbsp;[[special:Prefixindex/user talk:{{BASEPAGENAME}}/Archive|archived talks]]&nbsp;·&nbsp;[[b:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|b:]]&nbsp;·&nbsp;[[c:user:{{BASEPAGENAME}}|c:]]&nbsp;·&nbsp;[[d:user:{{BASEPAGENAME}}|d:]]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}|m:]]&nbsp;·&nbsp;[[mw:user:{{BASEPAGENAME}}|mw:]]&nbsp;·&nbsp;[[n:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|n:]]&nbsp;·&nbsp;[[q:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|q:]]&nbsp;·&nbsp;[[s:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|s:]]&nbsp;·&nbsp;[[testwiki:user:{{BASEPAGENAME}}|t:]]&nbsp;·&nbsp;[[v:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|v:]]&nbsp;·&nbsp;[[voy:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|voy:]]&nbsp;·&nbsp;[[w:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[wikt:{{CONTENTLANG}}:user:{{BASEPAGENAME}}|wikt:]]&nbsp;·&nbsp;[[w:en:user:{{BASEPAGENAME}}|w:en:]]&nbsp;·&nbsp;[[w:user:{{BASEPAGENAME}}|w:]]&nbsp;·&nbsp;[[:en:user:{{BASEPAGENAME}}|:en:]]&lrm;</span></sup><!-- special:foobar --> : <sup><span dir "ltr" class="plainlinks" >&nbsp;[{{fullurl:special:WhatLinksHere/{{FULLPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;WLH]&lrm;&nbsp;· [{{fullurl:special:RecentChanges|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;RC]&lrm;&nbsp;· [{{fullurl:special:Logs|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;logs]&lrm;&nbsp;· [{{fullurl:special:WatchList|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;watchlist]&lrm;&nbsp;· [{{fullurl:special:Contributions/{{BASEPAGENAME}}|uselang=en}}#top <span LANG="en" >'''local'''&nbsp;ontributions]&lrm;&nbsp;· [[mediawiki:Common.css|'''local'''&nbsp;mediawiki:Common.css]]&nbsp;· [[mediawiki:Common.js|'''local'''&nbsp;mediawiki:Common.js]]&nbsp;· [[mediawiki:Gadgets-definition|'''local'''&nbsp;mediawiki:Gadgets-definition]]&nbsp;· '''[[special:Notifications|local notifications]]'''<br />[[m:user:{{BASEPAGENAME}}/global.css|m:…'''/global.css''']]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}/global.js|m:…'''/global.js''']]&nbsp;·&nbsp;[[special:centralAuth/{{BASEPAGENAMEE}}|'''global'''&nbsp;account&nbsp;information]]&nbsp;· [https://tools.wmflabs.org/guc/?user={{URLENCODE:{{BASEPAGENAME}}|WIKI}} '''global'''&nbsp;user&nbsp;contributions]<!-- &nbsp;· [https://toolserver.org/~River/cgi-bin/count_edits?user={{BASEPAGENAMEE}}&dbname=wikidatawiki_p&machread=1] --></span></sup><!-- PAGEID related links --> : <sup><span dir "ltr" class="plainlinks" >'''PAGEID:'''&nbsp;{{PAGEID}}&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}#top links&nbsp;'''here''']&nbsp;· <sup>[https:{{SERVER}}/?curid={{PAGEID}}&action=purge# purge&nbsp;↺]&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}&action=edit&section=0# section=0]</sup>&nbsp;· '''REVISIONID:'''&nbsp;{{REVISIONID}}&nbsp;· [https:{{SERVER}}/?oldid={{REVISIONID}}# permanent&nbsp;link]&nbsp;· (layout:&nbsp;2015-09-07…d&nbsp;[https://fi.wikipedia.org/?curid=468081#top LTR]&nbsp;[https://ug.wiktionary.org/?curid=5716#top RTL]&nbsp;short)&lrm;</span></sup><!-- testing and validation links related languages / dialects --> : <sup><span dir "ltr" class="plainlinks" >'''testing and validation links:'''&nbsp;[[user:בײַ מיר ביסטו שיין#BiDi_issues|BiDi issues]]&nbsp;· [[user:I18n|gadget issues]]&nbsp;· '''related languages / dialects:'''&nbsp;[[w:foo:user:{{BASEPAGENAME}}|w:foo:]]&nbsp;·&nbsp;[[w:bar:user:{{BASEPAGENAME}}|w:bar:]]&lrm;</span></sup> </center> ---- <!-- <br clear="all" /> --> __TOC__ == <span dir="ltr" >Welcome&lrm;&nbsp;<span id="Welcome" dir="ltr" >{{PAGENAME}}</span>&nbsp;to&nbsp;<span id="WelcomeToSITENAME" dir="ltr" >{{SITENAME}}</span>!</span> == : [[Gebruiker:I18n|I18n]] ([[Gebruikerbespreking:I18n|kontak]]) 08:46, 7 September 2015 (UTC) : [[Gebruiker:I18n|I18n]] ([[Gebruikerbespreking:I18n|kontak]]) 08:57, 9 September 2015 (UTC) 5sjz4j2653o268r6l0y8ff961aw66pz Gebruikerbespreking:Hidayatsrf 3 2755 5159 2015-09-18T00:25:54Z Hidayatsrf 1631 Nuwe bladsy geskep met '{| class="float-center" border="0" cellpadding="0" cellspacing="0" style="background:#efefef; color:black" align="center" LANG="en" |- | align="left" | {{Softredirect|1=m...' 5159 wikitext text/x-wiki {| class="float-center" border="0" cellpadding="0" cellspacing="0" style="background:#efefef; color:black" align="center" LANG="en" |- | align="left" | {{Softredirect|1=m:user talk:{{PAGENAME}}|2=<span dir="ltr" >meta:user talk:<span dir="ltr" >{{PAGENAME}}</span></span>}} |- | align="right" | [[image:Redirectltr.png|right]] | align="left" | [[w:id:user talk:{{PAGENAME}}]] |- | align="right" | [[image:Redirectltr.png|right]] | align="left" dir="ltr" | [[w:en:user talk:Hidayatsrf]] |- | align="right" | [[Image:Redirectltr.png|right]] | align="left" dir="ltr" | '''[[User Talk:Hidayatsrf‏]] |- | <sup><span dir="ltr" class="plainlinks" >SITENAME: '''{{SITENAME}}'''&nbsp;· '''language:'''&nbsp;{{CONTENTLANG}}:&nbsp;'''[{{fullurl:{{FULLPAGENAME}}|uselang={{CONTENTLANG}}}}#top <span dir="ltr" LANG="{{CONTENTLANG}}" >{{#LANGUAGE:{{CONTENTLANG}}}}</span>]'''&nbsp;· &nbsp;[{{fullurl:{{FULLPAGENAME}}|uselang=en}}#top <span dir="ltr" LANG="en" >{{#LANGUAGE:{{CONTENTLANG}}|en}}</span>''']&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=de}}#top <span dir="ltr" LANG="de" >{{#LANGUAGE:{{CONTENTLANG}}|de}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=es}}#top <span dir="ltr" LANG="es" >{{#LANGUAGE:{{CONTENTLANG}}|es}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=fr}}#top <span dir="ltr" LANG="fr" >{{#LANGUAGE:{{CONTENTLANG}}|fr}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=it}}#top <span dir="ltr" LANG="it" >{{#LANGUAGE:{{CONTENTLANG}}|it}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ru}}#top <span dir="ltr" LANG="ru" >{{#LANGUAGE:{{CONTENTLANG}}|ru}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=zh}}#top <span dir="ltr" LANG="zh" >{{#LANGUAGE:{{CONTENTLANG}}|zh}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=ar}}#top <span dir="ltr" LANG="ar" >{{#LANGUAGE:{{CONTENTLANG}}|ar}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=he}}#top <span dir="ltr" LANG="he" >{{#LANGUAGE:{{CONTENTLANG}}|he}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=hi}}#top <span dir="ltr" LANG="hi" >{{#LANGUAGE:{{CONTENTLANG}}|hi}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}|uselang=eo}}#top <span dir="ltr" LANG="eo" >{{#LANGUAGE:{{CONTENTLANG}}|eo}}</span>]&nbsp;· [{{fullurl:{{FULLPAGENAME}}}}#footer #footer]</span></sup> |- |'''[[special:Notifications|local notifications]]'''<br />[[m:user:{{BASEPAGENAME}}/global.css|m:…'''/global.css''']]&nbsp;·&nbsp;[[m:user:{{BASEPAGENAME}}/global.js|m:…'''/global.js''']]&nbsp;·&nbsp;[[special:centralAuth/{{BASEPAGENAMEE}}|'''global'''&nbsp;account&nbsp;information]]&nbsp;· [https://tools.wmflabs.org/guc/?user={{URLENCODE:{{BASEPAGENAME}}|WIKI}} '''global'''&nbsp;user&nbsp;contributions] |- | <sup><span dir "ltr" class="plainlinks" >'''PAGEID:'''&nbsp;{{PAGEID}}&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}#top links&nbsp;'''here''']&nbsp;· <sup>[https:{{SERVER}}/?curid={{PAGEID}}&action=purge# purge&nbsp;↺]&nbsp;· [https:{{SERVER}}/?curid={{PAGEID}}&action=edit&section=0# section=0]</sup>&nbsp;· '''REVISIONID:'''&nbsp;{{REVISIONID}}&nbsp;· [https:{{SERVER}}/?oldid={{REVISIONID}}# permanent&nbsp;link]&nbsp;· |} 5a6seoc3ek4zuasew39xa04l8oepat8 Sjabloon:LQT Moved thread stub converted to Flow 10 2756 5161 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5161 wikitext text/x-wiki This post by {{{author}}} was moved on {{{date}}}. You can find it at [[{{{title}}}]]. e5j16chw2130kmdotptl65jvxa6lw5w Sjabloon:LQT page converted to Flow 10 2757 5162 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5162 wikitext text/x-wiki Previous page history was archived for backup purposes at <span class='flow-link-to-archive'>[[{{{archive}}}]]</span> on {{#time: Y-m-d|{{{date}}}}}. njhr9sbh7lx81p2xfwikn7amdd3n1zn Sjabloon:Archive for converted LQT page 10 2758 5163 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5163 wikitext text/x-wiki This page is an archived LiquidThreads page. '''Do not edit the contents of this page'''. Please direct any additional comments to the [[{{{from}}}|current talk page]]. nigyidinm7czjt0s9dq851dwhckapia Sjabloon:LQT post imported with supressed user 10 2759 5164 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5164 wikitext text/x-wiki This revision was imported from LiquidThreads with a suppressed user. It has been reassigned to the current user. 1pswkbcu7hauadd98nklgf3pku080ee Sjabloon:LQT post imported with different signature user 10 2760 5165 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5165 wikitext text/x-wiki ''This post was posted by [[User:{{{authorUser}}}|{{{authorUser}}}]], but signed as [[User:{{{signatureUser}}}|{{{signatureUser}}}]].'' gr9xg2oo9p9alcaf8usi587bcmsi65s Sjabloon:Wikitext talk page converted to Flow 10 2761 5166 2015-10-02T19:52:09Z Flow talk page manager 1613 /* Automatically created by Flow */ 5166 wikitext text/x-wiki Previous discussion was archived at <span class='flow-link-to-archive'>[[{{{archive}}}]]</span> on {{#time: Y-m-d|{{{date}}}}}. ccusakfp9y2sl227h5sbt4ok1ptcsxi Sjabloon:Archive for converted wikitext talk page 10 2762 5167 2015-10-02T19:52:10Z Flow talk page manager 1613 /* Automatically created by Flow */ 5167 wikitext text/x-wiki This page is an archive. '''Do not edit the contents of this page'''. Please direct any additional comments to the [[{{{from|{{TALKSPACE}}:{{BASEPAGENAME}}}}}|current talk page]]. hd1xxik7k0u7gcb9oq9ddgh20zmhpy4 Gebruikerbespreking:Stewi101015 3 2763 5170 2015-10-19T05:00:07Z Stewi101015 1644 Leë bladsy geskep 5170 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruiker:Hahc21 2 2768 5186 2015-12-30T19:01:23Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21]] na [[Gebruiker:Razr Nation]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5186 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Razr Nation]] k3y5mro6vl67jiznwa5vi5mksisa8jz Gebruiker:Hahc21/common.css 2 2769 5188 2015-12-30T19:03:00Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21/common.css]] na [[Gebruiker:Razr Nation/common.css]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5188 css text/css /* #REDIRECT */@import url(//af.wikibooks.org/w/index.php?title=Gebruiker:Razr_Nation/common.css&action=raw&ctype=text/css); 7uh94qbq96c0chwib0t6rychx7lg42v Gebruiker:Hahc21/common.js 2 2770 5190 2015-12-30T19:04:28Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Hahc21/common.js]] na [[Gebruiker:Razr Nation/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Hahc21|Hahc21]]" to "[[Special:CentralAuth/Razr Nation|Razr Nation]]" 5190 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:Razr_Nation/common.js\u0026action=raw\u0026ctype=text/javascript"); lqenngq6rigp7dtagu1wa1jb0hy874e Gebruiker:Pinus 2 2771 5199 2016-04-26T18:32:41Z Cyberpower678 1693 Cyberpower678 het bladsy [[Gebruiker:Pinus]] na [[Gebruiker:Prenn]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Pinus|Pinus]]" to "[[Special:CentralAuth/Prenn|Prenn]]" 5199 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Prenn]] 2ttrs5h4quegpgrsu4ymrzrvok5ye6c Gebruiker:Riley Huntley 2 2774 5205 2016-05-04T18:40:32Z Steinsplitter 1142 Steinsplitter het bladsy [[Gebruiker:Riley Huntley]] na [[Gebruiker:~riley]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Riley Huntley|Riley Huntley]]" to "[[Special:CentralAuth/~riley|~riley]]" 5205 wikitext text/x-wiki #AANSTUUR [[Gebruiker:~riley]] lyyrc5xo0gnmfydfofet0d951d0mory Gebruikerbespreking:HakanIST 3 2775 5207 2016-05-21T08:16:35Z HakanIST 1707 redirect to my main talk page 5207 wikitext text/x-wiki #REDIRECT [[m:User_talk:HakanIST]] ma80ys6tyyeuuvkmjl8wic828n6kzw0 Gebruiker:G(x)-former 2 2779 5219 2016-08-25T09:50:32Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:G(x)-former]] na [[Gebruiker:V(g)]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/G(x)-former|G(x)-former]]" to "[[Special:CentralAuth/V(g)|V(g)]]" 5219 wikitext text/x-wiki #AANSTUUR [[Gebruiker:V(g)]] s2gj71cbe1wsfwpskmldj039l8v60wl Gebruikerbespreking:G(x)-former 3 2780 5221 2016-08-25T09:50:33Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruikerbespreking:G(x)-former]] na [[Gebruikerbespreking:V(g)]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/G(x)-former|G(x)-former]]" to "[[Special:CentralAuth/V(g)|V(g)]]" 5221 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:V(g)]] khqqa2eqfd4lfiyvo8x3sf3atdgjhkq Bespreking:Tuisblad/Susterprojekte 1 2784 5230 5229 2017-01-02T18:24:13Z Samuele2002 1787 5230 wikitext text/x-wiki Hello sorry for my english I am admin on it.wikiversity and I want to tell you that there is no af.wikiversity pleasePlease could you remove Wikiversity or you could put the link to beta.wikiversity thanks :) (I would have done but I can not edit the page) --[[Gebruiker:Samuele2002|Samuele2002]] ([[Gebruikerbespreking:Samuele2002|kontak]]) 18:23, 2 Januarie 2017 (UTC) i5uruf07tvlub5a5p6dbkyzsr19iu9o Gebruiker:Ⓝⓘⓙⓦⓜ 2 2785 7201 5232 2022-10-24T23:03:59Z Maintenance script 1562 Maintenance script het bladsy [[Gebruiker:ⓝⓘⓙⓦⓜ]] na [[Gebruiker:Ⓝⓘⓙⓦⓜ]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/ⓝⓘⓙⓦⓜ|ⓝⓘⓙⓦⓜ]]" to "[[Special:CentralAuth/Ⓝⓘⓙⓦⓜ|Ⓝⓘⓙⓦⓜ]]" 5232 wikitext text/x-wiki [[:m:User:ⓝⓘⓙⓦⓜ]] t5ooobiz14r5z0szxeo63l87mfyp3gk Gebruiker:Morphypnos/common.js 2 2786 5234 2017-02-15T22:16:53Z Litlok 1804 Litlok het bladsy [[Gebruiker:Morphypnos/common.js]] na [[Gebruiker:La fée Didier/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Morphypnos|Morphypnos]]" to "[[Special:CentralAuth/La fée Didier|La fée Di... 5234 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:La_f%C3%A9e_Didier/common.js\u0026action=raw\u0026ctype=text/javascript"); 1ymb68gqpwsoolr29t713imy6xwk9q2 Gebruiker:Allan Aguilar/common.js 2 2787 5236 2017-02-16T11:55:05Z Savh 636 Savh het bladsy [[Gebruiker:Allan Aguilar/common.js]] na [[Gebruiker:Green Mostaza/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Allan Aguilar|Allan Aguilar]]" to "[[Special:CentralAuth/Green Mostaza|Green... 5236 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:Green_Mostaza/common.js\u0026action=raw\u0026ctype=text/javascript"); 5865tthkh9sxvvxk1iwzkv5m7mghgxh Spaans 0 2788 7321 7217 2023-11-08T02:53:13Z Salvabl 2571 7321 wikitext text/x-wiki [[File:Map-Hispanophone World.svg|frameless|upright=2|right]] Hierdie Wikiboek het ten doel om die leser 'n begrip, matig of ten volle, van die Spaans taal te gee. {{wikipedia|Spaans}} [[Kategorie:Boeke]] [[Kategorie:Tale]] 2c2o3h8whk7lhe6qtl3lmnfh81zq1ct Sjabloon:User af-0 10 2792 5255 2017-08-16T09:37:42Z Samuele2002 1787 Stuur aan na [[Sjabloon:Gebruiker af-0]] 5255 wikitext text/x-wiki #REDIRECT [[Sjabloon:Gebruiker af-0]] 7zdxji1prkgwbo151c468n6rsgx6zvo Sjabloon:Gebruiker af-0 10 2793 5256 2017-08-16T09:38:43Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #FFBBBB 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#FFEEEE"><tr> <td style="width:45px;heig...' 5256 wikitext text/x-wiki <div style="float:left;border:solid #FFBBBB 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#FFEEEE"><tr> <td style="width:45px;height:45px;background:#FFBBBB;text-align:center;font-size:14pt">'''[[:Afrikaans|af]]-0'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Hierdie persoon '''[[:Category:Gebruiker af-0|verstaan nie]] [[:Category:Gebruiker af|Afrikaans]]''' nie (of verstaan dit met groot moeite).</td> </tr></table></div><includeonly> [[Category:Gebruiker af-0|{{PAGENAME}}]] </includeonly><noinclude> [[Kategorie:Babelsjablone|Af-0]] <br clear="all"/> * '''af-0''', [[Sjabloon:Gebruiker_af-1|af-1]], [[Sjabloon:Gebruiker_af-2|af-2]], [[Sjabloon:Gebruiker_af-3|af-3]], [[Sjabloon:Gebruiker_af-4|af-4]] * [[Sjabloon:Gebruiker_af|af-N]] ---- *Om die bostaande ikoon te toon, bebruik <nowiki>{{Gebruiker_af-0}}</nowiki>. </noinclude> m3n0z5i012z54yt6jivnpo1jz09uthu Sjabloon:Gebruiker af-1 10 2794 5257 2017-08-16T09:39:31Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #E0C0E0 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#F3E0F3"><tr> <td style="width:45px;heig...' 5257 wikitext text/x-wiki <div style="float:left;border:solid #E0C0E0 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#F3E0F3"><tr> <td style="width:45px;height:45px;background:#E0C0E0;text-align:center;font-size:14pt">'''[[:Afrikaans|af]]-1'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Hierdie gebruiker het 'n '''[[:Category:Gebruiker af-1|basiese]]''' begrip van '''[[:Category:Gebruiker af|Afrikaans]]'''.</td> </tr></table></div><includeonly> [[Kategorie:Gebruiker af|{{PAGENAME}}]] [[Kategorie:Gebruiker af-1|{{PAGENAME}}]] </includeonly> <noinclude> [[Kategorie:Babelsjablone|Af-1]] <br clear="all"/> * [[Sjabloon:Gebruiker_af-0|af-0]], '''af-1''', [[Sjabloon:Gebruiker_af-2|af-2]], [[Sjabloon:Gebruiker_af-3|af-3]], [[Sjabloon:Gebruiker_af-4|af-4]] * [[Sjabloon:Gebruiker_af|af-N]] ---- *Om die bostaande ikoon te toon, bebruik <nowiki>{{Gebruiker_af-1}}</nowiki>. </noinclude> 8qu9hat47va8z7r5tqbe0cfpd4wnn9b Sjabloon:Gebruiker af-2 10 2795 5258 2017-08-16T09:40:09Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #BCB9EF 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#E9E5F9"><tr> <td style="width:45px;heig...' 5258 wikitext text/x-wiki <div style="float:left;border:solid #BCB9EF 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#E9E5F9"><tr> <td style="width:45px;height:45px;background:#BCB9EF;text-align:center;font-size:14pt">'''[[:Afrikaans|af]]-2'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Hierdie gebruiker het 'n '''[[:Kategorie:Gebruiker af-2|gemiddelde]]''' begrip van '''[[:Kategorie:Gebruiker af|Afrikaans]]'''.</td> </tr></table></div><includeonly> [[Kategorie:Gebruiker_af-2|{{PAGENAME}}]] </includeonly> <noinclude> [[Kategorie:Babelsjablone|Af-2]] <br clear="all"/> * [[Sjabloon:Gebruiker_af-0|af-0]], [[Sjabloon:Gebruiker_af-1|af-1]], '''af-2''', [[Sjabloon:Gebruiker_af-3|af-3]], [[Sjabloon:Gebruiker_af-4|af-4]] * [[Sjabloon:Gebruiker_af|af-N]] ---- *Om die bostaande ikoon te toon, bebruik <nowiki>{{Gebruiker_af-2}}</nowiki>. </noinclude> cyfmffo9odeeqxt7kmvwsvbworc67g3 Sjabloon:Gebruiker af-3 10 2796 5259 2017-08-16T09:40:51Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #A1CAF1 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#DCF0FF"><tr> <td style="width:45px;heig...' 5259 wikitext text/x-wiki <div style="float:left;border:solid #A1CAF1 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px;width:238px;background:#DCF0FF"><tr> <td style="width:45px;height:45px;background:#A1CAF1;text-align:center;font-size:14pt">'''[[:Afrikaans|af]]-3'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Hierdie gebruiker het 'n '''[[:Kategorie:Gebruiker af-3|uitstekende]]''' begrip van '''[[:Kategorie:Gebruiker af|Afrikaans]]'''.</td> </tr></table></div><includeonly> [[Kategorie:Gebruiker af|{{PAGENAME}}]] [[Kategorie:Gebruiker af-3|{{PAGENAME}}]] </includeonly> <noinclude> <br clear="all"/> * [[Sjabloon:Gebruiker_af-0|af-0]], [[Sjabloon:Gebruiker_af-1|af-1]], [[Sjabloon:Gebruiker_af-2|af-2]], '''af-3''', [[Sjabloon:Gebruiker_af-4|af-4]] * [[Sjabloon:Gebruiker_af|af-N]] ---- *Om die bostaande ikoon te toon, bebruik <nowiki>{{Gebruiker_af-3}}</nowiki>. [[Kategorie:Babelsjablone|Af-3]] </noinclude> adqafkrpc4sh518dmz4ox8y19avqfpt Sjabloon:Gebruiker af-4 10 2797 5260 2017-08-16T09:41:49Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #B0E0E6 1px;margin:1px"> {| cellspacing="0" style="margin-left:0px;width:238px;background:#F0FFFF" | style="width:45px;height:45px;bac...' 5260 wikitext text/x-wiki <div style="float:left;border:solid #B0E0E6 1px;margin:1px"> {| cellspacing="0" style="margin-left:0px;width:238px;background:#F0FFFF" | style="width:45px;height:45px;background:#B0E0E6;text-align:center;font-size:14pt" | '''[[:Afrikaans|af]]-4''' | style="font-size:8pt;padding:4pt;line-height:1.25em" | Hierdie gebruiker praat '''[[:Kategorie:Gebruiker af|Afrikaans]]''' op '''[[:Kategorie:Gebruiker af-4|moedertaalvlak]]'''. |}</div><includeonly> [[Kategorie:Gebruiker af|{{PAGENAME}}]] [[Kategorie:Gebruiker af-4|{{PAGENAME}}]] </includeonly> <noinclude> [[Kategorie:Babelsjablone|Af-4]] <br clear="all"/> * [[Sjabloon:Gebruiker_af-0|af-0]], [[Sjabloon:Gebruiker_af-1|af-1]], [[Sjabloon:Gebruiker_af-2|af-2]], [[Sjabloon:Gebruiker_af-3|af-3]], '''af-4''' * [[Sjabloon:Gebruiker_af|af-N]] <noinclude> ---- *Om die bostaande ikoon te toon, bebruik <nowiki>{{Gebruiker_af-4}}</nowiki>. eppq5fg44nwh4egksxczatpk0y7w5ax Sjabloon:Gebruiker af 10 2798 5261 2017-08-16T09:43:00Z Samuele2002 1787 Nuwe bladsy geskep met '<div style="float:left;border:solid #AAF0D1 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px; width:238px;background:#F0FFF0;"><tr> <td style="width:45px;h...' 5261 wikitext text/x-wiki <div style="float:left;border:solid #AAF0D1 1px;margin:1px"> <table cellspacing="0" style="margin-left:0px; width:238px;background:#F0FFF0;"><tr> <td style="width:45px;height:45px;background:#AAF0D1;text-align:center;font-size:14pt">'''[[:Afrikaans|af]]'''</td> <td style="font-size:8pt;padding:4pt;line-height:1.25em">Hierdie gebruiker se '''[[:Kategorie:Gebruiker af-N|moedertaal]]''' is '''[[:Kategorie:Gebruiker af|Afrikaans]]'''.</td> </tr></table></div><includeonly> [[Kategorie:Gebruiker af|{{PAGENAME}}]] [[Kategorie:Gebruiker af-N|{{PAGENAME}}]] </includeonly> <noinclude> [[Kategorie:Babelsjablone|Af]] <br clear="all"/> * [[Sjabloon:Gebruiker_af-0|af-0]], [[Sjabloon:Gebruiker_af-1|af-1]], [[Sjabloon:Gebruiker_af-2|af-2]], [[Sjabloon:Gebruiker_af-3|af-3]], [[Sjabloon:Gebruiker_af-4|af-4]] * '''af-N''' <noinclude> ---- *Om die bostaande ikoon te toon, gebruik <nowiki>{{Gebruiker_af}}</nowiki>. </noinclude> povnq9rgepumhshcjvsy3yxpe9xkzz2 Kategorie:Babelsjablone 14 2799 5262 2017-08-16T09:44:27Z Samuele2002 1787 Nuwe bladsy geskep met '{{CommonsKategorie|Babel box templates}} [[Kategorie:Gebruikersjablone]]' 5262 wikitext text/x-wiki {{CommonsKategorie|Babel box templates}} [[Kategorie:Gebruikersjablone]] qvuyjdyisa25crbpe56r8q2bgaf5pn8 Gebruiker:Paul.schrepfer 2 2800 5263 2017-09-08T16:59:23Z Paul.schrepfer 1863 Bonjour 5263 wikitext text/x-wiki Bonjour et bienvenue sur cette page 7mq3kzw7y4tsdbqvl3tmos4pmlqjovg Gebruiker:Brubaker610 2 2801 7168 7159 2022-02-16T19:42:17Z Base 1005 Base het bladsy [[Gebruiker:Vanished user jfyedt7]] na [[Gebruiker:Brubaker610]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Vanished user jfyedt7|Vanished user jfyedt7]]" to "[[Special:CentralAuth/Brubaker610|Brubaker610]]" 5264 wikitext text/x-wiki {{#babel:af-0}} 4o2bjlcrtvt4cergajbuk8fmvoh3xb2 Gebruiker:분당선M/common.css 2 2804 5269 2017-12-06T21:02:54Z -revi 1254 -revi het bladsy [[Gebruiker:분당선M/common.css]] na [[Gebruiker:*Youngjin/common.css]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5269 css text/css /* #REDIRECT */@import url("//af.wikibooks.org/w/index.php?title=Gebruiker:*Youngjin/common.css&action=raw&ctype=text/css"); hw9psgkyjnhqb1fytacj6v6lpa5k7h3 Gebruiker:분당선M/common.js 2 2805 5271 2017-12-06T21:02:55Z -revi 1254 -revi het bladsy [[Gebruiker:분당선M/common.js]] na [[Gebruiker:*Youngjin/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5271 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:*Youngjin/common.js\u0026action=raw\u0026ctype=text/javascript"); 41ozijzy7axt6qh7emtdf6plm0nzarm Gebruikerbespreking:분당선M 3 2806 5273 2017-12-06T21:02:55Z -revi 1254 -revi het bladsy [[Gebruikerbespreking:분당선M]] na [[Gebruikerbespreking:*Youngjin]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/분당선M|분당선M]]" to "[[Special:CentralAuth/*Youngjin|*Youngjin]]" 5273 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:*Youngjin]] t418sjvwf1edr85wshvbl3l2g24wjli Gebruiker:Ks-M9 2 2807 5275 2018-02-02T10:50:52Z MarcoAurelio 1232 MarcoAurelio het bladsy [[Gebruiker:Ks-M9]] na [[Gebruiker:Stïnger]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Ks-M9|Ks-M9]]" to "[[Special:CentralAuth/Stïnger|Stïnger]]" 5275 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Stïnger]] 6t4ot3bkhxterir9mosbp4fzp4go9re Gebruiker:Miguel2706 2 2808 7228 5277 2023-03-13T15:22:27Z EmausBot 1982 Robot: dubbele aanstuur na [[Gebruiker:Renamed user 9thz5duyuxms]] reggemaak 7228 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Renamed user 9thz5duyuxms]] 68pwq5k51r675c5kv6q51s4syqns05c Gebruiker:Miguel2706/common.js 2 2809 5279 2018-02-08T02:50:18Z Matiia 1510 Matiia het bladsy [[Gebruiker:Miguel2706/common.js]] na [[Gebruiker:KernelFreeze/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Miguel2706|Miguel2706]]" to "[[Special:CentralAuth/KernelFreeze|KernelFreeze]]" 5279 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:KernelFreeze/common.js\u0026action=raw\u0026ctype=text/javascript"); 9ms0aa5umjd4pkdqucttdl9bkhk3t7c Gebruiker:Etienfr 2 2810 5281 2018-02-12T08:08:22Z Cyberpower678 1693 Cyberpower678 het bladsy [[Gebruiker:Etienfr]] na [[Gebruiker:Limotecariu]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Etienfr|Etienfr]]" to "[[Special:CentralAuth/Limotecariu|Limotecariu]]" 5281 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Limotecariu]] 23juiq8tg1ux96ktb478r1jcri9mimr Sjabloon:Welkom 10 2811 5282 2018-02-19T09:05:48Z Pynappel 1845 Nuwe bladsy geskep met ''''Beste <includeonly>{{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}</includeonly>''', [[Wikibooks:Welkom|welkom op Wikibooks!]]<noinclude> Kategorie:Sjablone|{{PA...' 5282 wikitext text/x-wiki '''Beste <includeonly>{{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}</includeonly>''', [[Wikibooks:Welkom|welkom op Wikibooks!]]<noinclude> [[Kategorie:Sjablone|{{PAGENAME}}]] </noinclude> atbwuinngg2re84b6zodcs3ljlg7f36 Gebruikerbespreking:Leiem 3 2812 5283 2018-02-19T09:10:19Z KabouterBot 1931 Welkom! 5283 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:10, 19 Februarie 2018 (UTC) 2m3qjvn174uud2rjqbr8asnyjv3f179 Gebruikerbespreking:Wwikix 3 2813 5284 2018-02-19T09:10:29Z KabouterBot 1931 Welkom! 5284 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:10, 19 Februarie 2018 (UTC) 2m3qjvn174uud2rjqbr8asnyjv3f179 Gebruikerbespreking:Ureqqqqq 3 2814 5285 2018-02-19T09:10:39Z KabouterBot 1931 Welkom! 5285 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:10, 19 Februarie 2018 (UTC) 2m3qjvn174uud2rjqbr8asnyjv3f179 Gebruikerbespreking:MyContribution 3 2815 5286 2018-02-19T09:10:49Z KabouterBot 1931 Welkom! 5286 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:10, 19 Februarie 2018 (UTC) 2m3qjvn174uud2rjqbr8asnyjv3f179 Gebruikerbespreking:Veracious 3 2816 5287 2018-02-19T09:10:59Z KabouterBot 1931 Welkom! 5287 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:10, 19 Februarie 2018 (UTC) 2m3qjvn174uud2rjqbr8asnyjv3f179 Gebruikerbespreking:Manvydasz 3 2817 5288 2018-02-19T09:11:09Z KabouterBot 1931 Welkom! 5288 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruikerbespreking:Heinz 3 2818 5289 2018-02-19T09:11:19Z KabouterBot 1931 Welkom! 5289 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruikerbespreking:Jayprakash12345 3 2819 5290 2018-02-19T09:11:29Z KabouterBot 1931 Welkom! 5290 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruiker:KabouterBot 2 2820 5291 2018-02-19T09:11:30Z KabouterBot 1931 Nuwe bladsy geskep met '== Projekte == * [[Gebruiker:KabouterBot|Wikibooks]] ([[Spesiaal:Bydraes/KabouterBot|bydraes]]) * [[:d:User:KabouterBot|Wikidata]] (:d:Special:Contributions/KabouterBot...' 5291 wikitext text/x-wiki == Projekte == * [[Gebruiker:KabouterBot|Wikibooks]] ([[Spesiaal:Bydraes/KabouterBot|bydraes]]) * [[:d:User:KabouterBot|Wikidata]] ([[:d:Special:Contributions/KabouterBot|bydraes]]) * [[:w:Gebruiker:KabouterBot|Wikipedia]] ([[:w:Spesiaal:Bydraes/KabouterBot|bydraes]]) * [[:q:Gebruiker:KabouterBot|Wikiquote]] ([[:q:Spesiaal:Bydraes/KabouterBot|bydraes]]) * [[:wikt:Gebruiker:KabouterBot|Wikiwoordeboek]] ([[:wikt:Spesiaal:Bydraes/KabouterBot|bydraes]]) kvhk4qdd8utb9pne35k418cxs1w78kp Gebruikerbespreking:Sigma'am 3 2821 5292 2018-02-19T09:11:39Z KabouterBot 1931 Welkom! 5292 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruikerbespreking:Luc Patin 3 2822 5619 5293 2019-01-25T22:52:44Z Ejs-80 1564 Ejs-80 het bladsy [[Gebruikerbespreking:Bilbo40]] na [[Gebruikerbespreking:Luc Patin]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Bilbo40|Bilbo40]]" to "[[Special:CentralAuth/Luc Patin|Luc Patin]]" 5293 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruikerbespreking:Assoc 3 2823 5294 2018-02-19T09:11:59Z KabouterBot 1931 Welkom! 5294 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:11, 19 Februarie 2018 (UTC) 1bwsuk3f0ojw928ah73crwa7y5evrqq Gebruikerbespreking:Épine 3 2824 5295 2018-02-19T09:12:09Z KabouterBot 1931 Welkom! 5295 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:स 3 2825 5296 2018-02-19T09:12:19Z KabouterBot 1931 Welkom! 5296 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:Surprizi 3 2826 5297 2018-02-19T09:12:29Z KabouterBot 1931 Welkom! 5297 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:Avicenno 3 2827 5630 5298 2019-05-13T13:03:15Z علاء 1834 علاء het bladsy [[Gebruikerbespreking:مصعب]] na [[Gebruikerbespreking:Avicenno]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/مصعب|مصعب]]" to "[[Special:CentralAuth/Avicenno|Avicenno]]" 5298 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:JogiAsad 3 2828 5299 2018-02-19T09:12:49Z KabouterBot 1931 Welkom! 5299 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:Janezdrilc 3 2829 5300 2018-02-19T09:12:59Z KabouterBot 1931 Welkom! 5300 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:12, 19 Februarie 2018 (UTC) ofwbaisrsyyrd773pgj9bfnvxvlg1lk Gebruikerbespreking:VASHGIRD 3 2830 5301 2018-02-19T09:13:09Z KabouterBot 1931 Welkom! 5301 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:Katxis 3 2831 5302 2018-02-19T09:13:19Z KabouterBot 1931 Welkom! 5302 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:S4b1nuz E.656 3 2832 5303 2018-02-19T09:13:29Z KabouterBot 1931 Welkom! 5303 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:Hammad 3 2833 5719 5304 2019-10-12T18:59:31Z علاء 1834 علاء het bladsy [[Gebruikerbespreking:BukhariSaeed]] na [[Gebruikerbespreking:Hammad]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/BukhariSaeed|BukhariSaeed]]" to "[[Special:CentralAuth/Hammad|Hammad]]" 5304 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:Hugo.arg 3 2834 5305 2018-02-19T09:13:49Z KabouterBot 1931 Welkom! 5305 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:Cethos 3 2835 5306 2018-02-19T09:13:59Z KabouterBot 1931 Welkom! 5306 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:13, 19 Februarie 2018 (UTC) i84sojpuyfrknqp7a8z6v3wnjlyfyzz Gebruikerbespreking:Nihlus 3 2836 5307 2018-02-19T09:14:09Z KabouterBot 1931 Welkom! 5307 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:Formatierer 3 2837 5308 2018-02-19T09:14:19Z KabouterBot 1931 Welkom! 5308 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:Draceane 3 2838 5309 2018-02-19T09:14:29Z KabouterBot 1931 Welkom! 5309 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:AAbdollahi 3 2839 5310 2018-02-19T09:14:39Z KabouterBot 1931 Welkom! 5310 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:Ykhwong 3 2840 5311 2018-02-19T09:14:49Z KabouterBot 1931 Welkom! 5311 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:Lien Shan 3 2841 5312 2018-02-19T09:14:59Z KabouterBot 1931 Welkom! 5312 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:14, 19 Februarie 2018 (UTC) 20u2cbv839mmue1t585f00bemaz4cs3 Gebruikerbespreking:PepikSocha 3 2842 5313 2018-02-19T09:15:09Z KabouterBot 1931 Welkom! 5313 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:RiniX 3 2843 5314 2018-02-19T09:15:19Z KabouterBot 1931 Welkom! 5314 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:Gumruch 3 2844 5315 2018-02-19T09:15:29Z KabouterBot 1931 Welkom! 5315 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:Athena in Wonderland 3 2845 5316 2018-02-19T09:15:39Z KabouterBot 1931 Welkom! 5316 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:Metrónomo 3 2846 5317 2018-02-19T09:15:49Z KabouterBot 1931 Welkom! 5317 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:StevenJ81 3 2847 5318 2018-02-19T09:15:59Z KabouterBot 1931 Welkom! 5318 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:15, 19 Februarie 2018 (UTC) ocv8xok2uonao43wk50ja9f3wdxwwg6 Gebruikerbespreking:Beka777Z 3 2848 5319 2018-02-19T09:16:09Z KabouterBot 1931 Welkom! 5319 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:Pippu d'Angelo 3 2849 5320 2018-02-19T09:16:19Z KabouterBot 1931 Welkom! 5320 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:Anzx-ooo 3 2850 7397 5614 2024-07-10T09:18:48Z Nadzik 2199 Nadzik het bladsy [[Gebruikerbespreking:User unavailable826]] na [[Gebruikerbespreking:Anzx-ooo]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/User unavailable826|User unavailable826]]" to "[[Special:CentralAuth/Anzx-ooo|Anzx-ooo]]" 5321 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:Iokseng 3 2851 5322 2018-02-19T09:16:39Z KabouterBot 1931 Welkom! 5322 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:Trizek (WMF) 3 2852 5323 2018-02-19T09:16:49Z KabouterBot 1931 Welkom! 5323 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:暖城2016-02-05 3 2853 5324 2018-02-19T09:16:59Z KabouterBot 1931 Welkom! 5324 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:16, 19 Februarie 2018 (UTC) kzhl3a691sbq0k401qasjbafv626p5g Gebruikerbespreking:책읽는달팽 3 2854 5325 2018-02-19T09:17:09Z KabouterBot 1931 Welkom! 5325 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:Matěj Suchánek 3 2855 5326 2018-02-19T09:17:19Z KabouterBot 1931 Welkom! 5326 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:GlobalCssJs migration script 3 2856 5327 2018-02-19T09:17:29Z KabouterBot 1931 Welkom! 5327 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:Doefie Loots 3 2857 5328 2018-02-19T09:17:39Z KabouterBot 1931 Welkom! 5328 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:Morne 3 2858 5329 2018-02-19T09:17:49Z KabouterBot 1931 Welkom! 5329 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:Itsused 3 2859 5330 2018-02-19T09:17:59Z KabouterBot 1931 Welkom! 5330 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:17, 19 Februarie 2018 (UTC) m13zbhrnyizx0lh22dknld16mwabndf Gebruikerbespreking:Jc86035 (1) 3 2860 5331 2018-02-19T09:18:09Z KabouterBot 1931 Welkom! 5331 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:18, 19 Februarie 2018 (UTC) 5mq71jrmz2fx6rne36j8tyk6cpgq2kl Gebruikerbespreking:CelestialKeystone 3 2861 5332 2018-02-19T09:23:02Z KabouterBot 1931 Welkom! 5332 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:Redrobsche 3 2862 5333 2018-02-19T09:23:12Z KabouterBot 1931 Welkom! 5333 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:Slovebz 3 2863 5334 2018-02-19T09:23:22Z KabouterBot 1931 Welkom! 5334 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:AugustusVarius 3 2864 5335 2018-02-19T09:23:32Z KabouterBot 1931 Welkom! 5335 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:Donald Trung 3 2865 5336 2018-02-19T09:23:42Z KabouterBot 1931 Welkom! 5336 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:Soothpuked 3 2866 5337 2018-02-19T09:23:52Z KabouterBot 1931 Welkom! 5337 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:23, 19 Februarie 2018 (UTC) e0xxskar0qtdy2osgzl8k9g74rjuims Gebruikerbespreking:Chrissy4 3 2867 5338 2018-02-19T09:24:02Z KabouterBot 1931 Welkom! 5338 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) nizecj83ve70xi1362dkvhthffpicl2 Gebruikerbespreking:Ajaybanbi 3 2868 5339 2018-02-19T09:24:12Z KabouterBot 1931 Welkom! 5339 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) nizecj83ve70xi1362dkvhthffpicl2 Gebruikerbespreking:1997kB 3 2869 6517 6516 2020-04-06T05:26:10Z 1997kB 1873 grammar 6517 wikitext text/x-wiki <div style="display: flex; flex-wrap: wrap; justify-content: center; align-items: center; margin: 16px 0; border: 1px solid #aaaaaa;"> <div style="padding: 12px;">[[File:OOjs UI icon pushPin.svg|75px|link=[[m:User_talk:1997kB]]]]</div> <div style="flex: 1; padding: 12px; background-color: #dddddd; color: #555555;"> <div style="font-weight: bold; font-size: 150%; color: red; font-family: 'Comic Sans MS'">Welcome to my talk page!</div> <div style="max-width: 700px">Hey! I am 1997kB. I patrol many projects and where I don't know the language I only act in cases of serious vandalism. If you think I have done anything wrong, feel free to message me. For ease of communication and to keep conversations in one place, I prefer you leave me messages at my [[:m:User_talk:1997kB|<mark style="color:red">'''talk page'''</mark>]] on metawiki. If you don't like that you can leave me messages here too, but since I do not watch all of my talk pages, your message might not get a timely response. Thanks! [[File:Face-smile.svg|18px|link=[[m:User:1997kB]]]]</div> </div> </div> <!-- Don't change anything above this line. Thank you! --> == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) ozvt0o7d3zuqphuvcx75bkataro4hzp Gebruikerbespreking:Michelo mwiinga 3 2870 5341 2018-02-19T09:24:32Z KabouterBot 1931 Welkom! 5341 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) nizecj83ve70xi1362dkvhthffpicl2 Gebruikerbespreking:Cmxsport 3 2871 5342 2018-02-19T09:24:42Z KabouterBot 1931 Welkom! 5342 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) nizecj83ve70xi1362dkvhthffpicl2 Gebruikerbespreking:レゴマン 3 2872 5343 2018-02-19T09:24:52Z KabouterBot 1931 Welkom! 5343 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:24, 19 Februarie 2018 (UTC) nizecj83ve70xi1362dkvhthffpicl2 Gebruikerbespreking:XenonNSMB 3 2873 5344 2018-02-19T09:25:02Z KabouterBot 1931 Welkom! 5344 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) g8rwfl0k0b2cdxm6c22ytksvvki4o2f Gebruikerbespreking:Frikvanrensburg 3 2874 5345 2018-02-19T09:25:12Z KabouterBot 1931 Welkom! 5345 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) g8rwfl0k0b2cdxm6c22ytksvvki4o2f Gebruikerbespreking:MmichaelDr. 3 2875 5346 2018-02-19T09:25:22Z KabouterBot 1931 Welkom! 5346 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) g8rwfl0k0b2cdxm6c22ytksvvki4o2f Gebruikerbespreking:Brubaker610 3 2876 7167 7158 2022-02-16T19:42:17Z Base 1005 Base het bladsy [[Gebruikerbespreking:Vanished user jfyedt7]] na [[Gebruikerbespreking:Brubaker610]] geskuif sonder om 'n aanstuur agter te laat: Automatically moved page while renaming the user "[[Special:CentralAuth/Vanished user jfyedt7|Vanished user jfyedt7]]" to "[[Special:CentralAuth/Brubaker610|Brubaker610]]" 5347 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) g8rwfl0k0b2cdxm6c22ytksvvki4o2f Gebruikerbespreking:Stefán Örvar Sigmundsson 3 2877 6686 5348 2020-06-21T16:58:44Z DutchTina 2131 DutchTina het bladsy [[Gebruikerbespreking:S.Örvarr.S]] na [[Gebruikerbespreking:Stefán Örvar Sigmundsson]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/S.Örvarr.S|S.Örvarr.S]]" to "[[Special:CentralAuth/Stefán Örvar Sigmundsson|Stefán Örvar Sigmundsson]]" 5348 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) g8rwfl0k0b2cdxm6c22ytksvvki4o2f Gebruikerbespreking:Paul.schrepfer 3 2878 5571 5349 2018-02-22T07:24:02Z Paul.schrepfer 1863 ajout 5571 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:25, 19 Februarie 2018 (UTC) * Hallo, bedankt dat je me hebt verwelkomd - Paul.schrepfer. kgd83rd6cbajmxuwk0h10kcsj72puvn Gebruikerbespreking:夢蝶葬花 3 2879 5611 5595 2018-12-16T04:01:52Z 1997kB 1873 1997kB het bladsy [[Gebruikerbespreking:五月雨恋歌]] na [[Gebruikerbespreking:夢蝶葬花]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/五月雨恋歌|五月雨恋歌]]" to "[[Special:CentralAuth/夢蝶葬花|夢蝶葬花]]" 5350 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Andreyyshore 3 2880 5351 2018-02-19T09:26:12Z KabouterBot 1931 Welkom! 5351 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Ou Bul 3 2881 5352 2018-02-19T09:26:22Z KabouterBot 1931 Welkom! 5352 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Lwllynherb 3 2882 5353 2018-02-19T09:26:32Z KabouterBot 1931 Welkom! 5353 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Zhoujiewith 3 2883 5354 2018-02-19T09:26:42Z KabouterBot 1931 Welkom! 5354 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Alextekle 3 2884 5355 2018-02-19T09:26:52Z KabouterBot 1931 Welkom! 5355 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:26, 19 Februarie 2018 (UTC) 2lcr6jbkggrzgflcsisr4mxcqgembsz Gebruikerbespreking:Mayurbhatt 3 2885 5356 2018-02-19T09:27:02Z KabouterBot 1931 Welkom! 5356 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:Srđan 3 2886 6763 5357 2020-07-15T00:18:19Z 蟲蟲飛 2193 蟲蟲飛 het bladsy [[Gebruikerbespreking:Srdjan m]] na [[Gebruikerbespreking:Srđan]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Srdjan m|Srdjan m]]" to "[[Special:CentralAuth/Srđan|Srđan]]" 5357 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:Omar2040 3 2887 6684 5358 2020-06-15T21:48:43Z Turkmen 2075 Turkmen het bladsy [[Gebruikerbespreking:Omar Ghrida]] na [[Gebruikerbespreking:Omar2040]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Omar Ghrida|Omar Ghrida]]" to "[[Special:CentralAuth/Omar2040|Omar2040]]" 5358 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:Paulo Luis Mussosso 3 2888 5359 2018-02-19T09:27:32Z KabouterBot 1931 Welkom! 5359 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:Enricoweermag 3 2889 5360 2018-02-19T09:27:42Z KabouterBot 1931 Welkom! 5360 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:منظمة ويكيميديا المجانية يونس 3 2890 5361 2018-02-19T09:27:52Z KabouterBot 1931 Welkom! 5361 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:27, 19 Februarie 2018 (UTC) rf72mx8kqynrvdiv87ick43sxms0j3x Gebruikerbespreking:SpesBona 3 2891 5362 2018-02-19T09:28:02Z KabouterBot 1931 Welkom! 5362 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) p8x9fav8qhxiu4wgripvhemwtbbkao0 Gebruikerbespreking:আফতাবুজ্জামান 3 2892 5588 5363 2018-06-25T04:04:05Z Moheen 1968 Moheen Reeyad het bladsy [[Gebruikerbespreking:Aftabuzzaman]] na [[Gebruikerbespreking:আফতাবুজ্জামান]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Aftabuzzaman|Aftabuzzaman]]" to "[[Special:CentralAuth/আফতাবুজ্জামান|আফতাবুজ্জামান]]" 5588 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) p8x9fav8qhxiu4wgripvhemwtbbkao0 Gebruikerbespreking:TrixAreForKidsSillyRabbit 3 2893 5364 2018-02-19T09:28:22Z KabouterBot 1931 Welkom! 5364 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) p8x9fav8qhxiu4wgripvhemwtbbkao0 Gebruikerbespreking:Veerappanvairavan 3 2894 5365 2018-02-19T09:28:32Z KabouterBot 1931 Welkom! 5365 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) p8x9fav8qhxiu4wgripvhemwtbbkao0 Gebruikerbespreking:Pynappel 3 2895 7359 5569 2023-12-17T22:12:30Z Cabayi 2047 Cabayi het bladsy [[Gebruikerbespreking:K175]] na [[Gebruikerbespreking:Pynappel]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/K175|K175]]" to "[[Special:CentralAuth/Pynappel|Pynappel]]" 5569 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) :Hello, K175. This new template seems to have a problem in the link. [[Gebruiker:Whatamidoing (WMF)|Whatamidoing (WMF)]] ([[Gebruikerbespreking:Whatamidoing (WMF)|kontak]]) 22:04, 19 Februarie 2018 (UTC) du1lb6xtfkb6fmdmv1aju13g6xgoeov Gebruikerbespreking:Noah Nyanza Kiyana 3 2896 5367 2018-02-19T09:28:52Z KabouterBot 1931 Welkom! 5367 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:28, 19 Februarie 2018 (UTC) p8x9fav8qhxiu4wgripvhemwtbbkao0 Gebruikerbespreking:DOIDCCO 3 2897 5368 2018-02-19T09:29:02Z KabouterBot 1931 Welkom! 5368 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:Simone Parisotto 3 2898 5369 2018-02-19T09:29:12Z KabouterBot 1931 Welkom! 5369 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:TheDJ 3 2899 5370 2018-02-19T09:29:22Z KabouterBot 1931 Welkom! 5370 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:Zaenon 3 2900 5371 2018-02-19T09:29:32Z KabouterBot 1931 Welkom! 5371 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:Zwandre 3 2901 5372 2018-02-19T09:29:42Z KabouterBot 1931 Welkom! 5372 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:Dostojewskij 3 2902 5373 2018-02-19T09:29:52Z KabouterBot 1931 Welkom! 5373 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:29, 19 Februarie 2018 (UTC) klmhl409df3hmgqu7nzrxsg4p77vk8x Gebruikerbespreking:Swerfvalk 3 2903 5374 2018-02-19T09:30:02Z KabouterBot 1931 Welkom! 5374 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:Ferdi2005 3 2904 5375 2018-02-19T09:30:12Z KabouterBot 1931 Welkom! 5375 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:علاء 3 2905 5376 2018-02-19T09:30:22Z KabouterBot 1931 Welkom! 5376 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:Nelson Ricardo 2500 3 2906 6835 5377 2021-05-17T14:58:51Z Deepfriedokra 2219 Deepfriedokra het bladsy [[Gebruikerbespreking:Nricardo]] na [[Gebruikerbespreking:Nelson Ricardo 2500]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Nricardo|Nricardo]]" to "[[Special:CentralAuth/Nelson Ricardo 2500|Nelson Ricardo 2500]]" 5377 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:Audrie Louw 3 2907 5378 2018-02-19T09:30:42Z KabouterBot 1931 Welkom! 5378 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:Tuxlie 3 2908 5379 2018-02-19T09:30:52Z KabouterBot 1931 Welkom! 5379 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:30, 19 Februarie 2018 (UTC) bkes5yy5juy7wqa3idr2a81fnjfznko Gebruikerbespreking:Cosmic Clone 3 2909 5380 2018-02-19T09:31:02Z KabouterBot 1931 Welkom! 5380 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:MannMaus 3 2910 5381 2018-02-19T09:31:12Z KabouterBot 1931 Welkom! 5381 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:Slentee 3 2911 5382 2018-02-19T09:31:22Z KabouterBot 1931 Welkom! 5382 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:Ladsgroup 3 2912 5383 2018-02-19T09:31:32Z KabouterBot 1931 Welkom! 5383 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:軽快 3 2913 5384 2018-02-19T09:31:42Z KabouterBot 1931 Welkom! 5384 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:Inarjis 3 2914 5385 2018-02-19T09:31:52Z KabouterBot 1931 Welkom! 5385 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:31, 19 Februarie 2018 (UTC) db3vgmau0c06cid482r4watdr72kxdl Gebruikerbespreking:Mitchell Warren 3 2915 5386 2018-02-19T09:32:02Z KabouterBot 1931 Welkom! 5386 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:سمان عيسى 3 2916 5387 2018-02-19T09:32:12Z KabouterBot 1931 Welkom! 5387 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:Adalhard 3 2917 7210 5388 2022-12-19T01:19:18Z Superpes15 2196 Superpes15 het bladsy [[Gebruikerbespreking:Adalhard Waffe]] na [[Gebruikerbespreking:Adalhard]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adalhard Waffe|Adalhard Waffe]]" to "[[Special:CentralAuth/Adalhard|Adalhard]]" 5388 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:Mpdpuma 3 2918 5389 2018-02-19T09:32:32Z KabouterBot 1931 Welkom! 5389 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:Slasher405 3 2919 5390 2018-02-19T09:32:42Z KabouterBot 1931 Welkom! 5390 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:Boing! said Zebedee 3 2920 5391 2018-02-19T09:32:52Z KabouterBot 1931 Welkom! 5391 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 09:32, 19 Februarie 2018 (UTC) qtrisi7qdrrl4orl0i7udfa7inysyza Gebruikerbespreking:Boing! on Tour 3 2922 5393 2018-02-19T11:13:25Z KabouterBot 1931 Welkom! 5393 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:13, 19 Februarie 2018 (UTC) jn16k9hyof250u9qyupdx460bdbx63b Gebruikerbespreking:Hhhggg2 3 2923 5394 2018-02-19T11:14:40Z KabouterBot 1931 Welkom! 5394 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:14, 19 Februarie 2018 (UTC) f6pgmeage6lhsnmn5he83k1my8oxhns Gebruikerbespreking:Josqu.GNU 3 2924 5395 2018-02-19T11:14:49Z KabouterBot 1931 Welkom! 5395 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:14, 19 Februarie 2018 (UTC) f6pgmeage6lhsnmn5he83k1my8oxhns Gebruikerbespreking:Whatamidoing (WMF) 3 2925 5396 2018-02-19T11:15:00Z KabouterBot 1931 Welkom! 5396 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:14, 19 Februarie 2018 (UTC) f6pgmeage6lhsnmn5he83k1my8oxhns Gebruikerbespreking:Nesmir Kudilovic 3 2926 5397 2018-02-19T11:15:09Z KabouterBot 1931 Welkom! 5397 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:Base (WMF) 3 2927 5398 2018-02-19T11:15:20Z KabouterBot 1931 Welkom! 5398 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:Carmelino Tchinanga 3 2928 5399 2018-02-19T11:15:29Z KabouterBot 1931 Welkom! 5399 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:Rokib3101 3 2929 5400 2018-02-19T11:15:40Z KabouterBot 1931 Welkom! 5400 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:Sebastien Daniels 3 2930 5401 2018-02-19T11:15:50Z KabouterBot 1931 Welkom! 5401 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:LuisH 3 2931 5402 2018-02-19T11:16:00Z KabouterBot 1931 Welkom! 5402 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:15, 19 Februarie 2018 (UTC) rjzl8bxd7brq57qzk55xqyotv1338ek Gebruikerbespreking:António Espiríto Santo 3 2932 5403 2018-02-19T11:16:10Z KabouterBot 1931 Welkom! 5403 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:16, 19 Februarie 2018 (UTC) h4cryowu80zz50rrce3zokhq64qb2ks Gebruikerbespreking:Domingos Ngola Domingos 3 2933 5404 2018-02-19T11:16:20Z KabouterBot 1931 Welkom! 5404 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:16, 19 Februarie 2018 (UTC) h4cryowu80zz50rrce3zokhq64qb2ks Gebruikerbespreking:Sben123 3 2934 5405 2018-02-19T11:16:30Z KabouterBot 1931 Welkom! 5405 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:16, 19 Februarie 2018 (UTC) h4cryowu80zz50rrce3zokhq64qb2ks Gebruikerbespreking:Litlok 3 2935 5406 2018-02-19T11:16:40Z KabouterBot 1931 Welkom! 5406 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:16, 19 Februarie 2018 (UTC) h4cryowu80zz50rrce3zokhq64qb2ks Gebruikerbespreking:Ⓝⓘⓙⓦⓜ 3 2936 5407 2018-02-19T11:16:50Z KabouterBot 1931 Welkom! 5407 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:16, 19 Februarie 2018 (UTC) h4cryowu80zz50rrce3zokhq64qb2ks Gebruikerbespreking:Amelia Minnaar 3 2937 5408 2018-02-19T11:17:00Z KabouterBot 1931 Welkom! 5408 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:BDavis (WMF) 3 2938 5409 2018-02-19T11:17:10Z KabouterBot 1931 Welkom! 5409 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:Mirinano 3 2939 5410 2018-02-19T11:17:20Z KabouterBot 1931 Welkom! 5410 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:Bgwhite 3 2940 5411 2018-02-19T11:17:30Z KabouterBot 1931 Welkom! 5411 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:Wargo 3 2941 5412 2018-02-19T11:17:40Z KabouterBot 1931 Welkom! 5412 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:Xxmarijnw 3 2942 5413 2018-02-19T11:17:50Z KabouterBot 1931 Welkom! 5413 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:17, 19 Februarie 2018 (UTC) 8xeoymeq26zcwsqs64c5s6y4nay447m Gebruikerbespreking:Alwanda 3 2943 5414 2018-02-19T11:18:00Z KabouterBot 1931 Welkom! 5414 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:18, 19 Februarie 2018 (UTC) jgxtv3nl6unmeqlie3fkjmosb9uomw5 Gebruikerbespreking:HalcyonL 3 2944 5415 2018-02-19T11:18:10Z KabouterBot 1931 Welkom! 5415 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:18, 19 Februarie 2018 (UTC) jgxtv3nl6unmeqlie3fkjmosb9uomw5 Gebruikerbespreking:JJMC89 3 2945 5567 5416 2018-02-19T15:53:27Z JJMC89 1794 soft redirect 5567 wikitext text/x-wiki __NOINDEX____NOEDITSECTION____NONEWSECTIONLINK__{{softredirect|meta:User talk:{{PAGENAME}}}} srx421gcshk3fa5tc0ag5px5380bkgx Gebruikerbespreking:Ping08 3 2946 5417 2018-02-19T11:18:30Z KabouterBot 1931 Welkom! 5417 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:18, 19 Februarie 2018 (UTC) jgxtv3nl6unmeqlie3fkjmosb9uomw5 Gebruikerbespreking:Ertrinken 3 2947 7221 5418 2023-02-26T21:19:00Z Cabayi 2047 Cabayi het bladsy [[Gebruikerbespreking:Gambler1478]] na [[Gebruikerbespreking:Ertrinken]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Gambler1478|Gambler1478]]" to "[[Special:CentralAuth/Ertrinken|Ertrinken]]" 5418 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:18, 19 Februarie 2018 (UTC) jgxtv3nl6unmeqlie3fkjmosb9uomw5 Gebruikerbespreking:Kaulder 3 2948 5419 2018-02-19T11:18:50Z KabouterBot 1931 Welkom! 5419 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:18, 19 Februarie 2018 (UTC) jgxtv3nl6unmeqlie3fkjmosb9uomw5 Gebruikerbespreking:Allen2 3 2949 5420 2018-02-19T11:19:00Z KabouterBot 1931 Welkom! 5420 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:EGalvez (WMF) 3 2950 5421 2018-02-19T11:19:10Z KabouterBot 1931 Welkom! 5421 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:Tulsi 3 2951 7186 5422 2022-07-09T03:41:42Z MdsShakil 2289 MdsShakil het bladsy [[Gebruikerbespreking:Tulsi Bhagat]] na [[Gebruikerbespreking:Tulsi]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Tulsi Bhagat|Tulsi Bhagat]]" to "[[Special:CentralAuth/Tulsi|Tulsi]]" 5422 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:Samuele2002 3 2952 5423 2018-02-19T11:19:30Z KabouterBot 1931 Welkom! 5423 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:Абдулло-Довуд 3 2953 5424 2018-02-19T11:19:40Z KabouterBot 1931 Welkom! 5424 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:Kiwipidae 3 2954 5425 2018-02-19T11:19:50Z KabouterBot 1931 Welkom! 5425 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:19, 19 Februarie 2018 (UTC) iosgj6ynyrajmigs3b0vagfi34kr91n Gebruikerbespreking:連綿 3 2955 5426 2018-02-19T11:20:00Z KabouterBot 1931 Welkom! 5426 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:Born4People 3 2956 5427 2018-02-19T11:20:10Z KabouterBot 1931 Welkom! 5427 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:David Poeta 3 2957 5428 2018-02-19T11:20:20Z KabouterBot 1931 Welkom! 5428 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:Euku 3 2958 5429 2018-02-19T11:20:30Z KabouterBot 1931 Welkom! 5429 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:101badr 3 2959 5430 2018-02-19T11:20:40Z KabouterBot 1931 Welkom! 5430 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:Daniel Johnily 3 2960 5431 2018-02-19T11:20:50Z KabouterBot 1931 Welkom! 5431 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:20, 19 Februarie 2018 (UTC) 8b3g921h66obnxsaepoejint2uaqhrz Gebruikerbespreking:Jmvkrecords 3 2961 5432 2018-02-19T11:21:00Z KabouterBot 1931 Welkom! 5432 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:Shirayuki 3 2962 5433 2018-02-19T11:21:10Z KabouterBot 1931 Welkom! 5433 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:Winhop 3 2963 5434 2018-02-19T11:21:20Z KabouterBot 1931 Welkom! 5434 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:Katzenjammer Kid 3 2964 5435 2018-02-19T11:21:30Z KabouterBot 1931 Welkom! 5435 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:SaschaDU 3 2965 5436 2018-02-19T11:21:40Z KabouterBot 1931 Welkom! 5436 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:SportsLair 3 2966 5437 2018-02-19T11:21:50Z KabouterBot 1931 Welkom! 5437 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:21, 19 Februarie 2018 (UTC) flqanekig3bs3u9u7m4irsay2z8u7n7 Gebruikerbespreking:אריאל131 3 2967 5438 2018-02-19T11:22:00Z KabouterBot 1931 Welkom! 5438 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:SportsPhenom 3 2968 5439 2018-02-19T11:22:10Z KabouterBot 1931 Welkom! 5439 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:JSutherland (WMF) 3 2969 5440 2018-02-19T11:22:20Z KabouterBot 1931 Welkom! 5440 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:Zeetendra 3 2970 5441 2018-02-19T11:22:30Z KabouterBot 1931 Welkom! 5441 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:Bfranze88 3 2971 5442 2018-02-19T11:22:40Z KabouterBot 1931 Welkom! 5442 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:Maurese M 3 2972 5443 2018-02-19T11:22:50Z KabouterBot 1931 Welkom! 5443 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:22, 19 Februarie 2018 (UTC) e3wyyrbhztegw56dc5w3p2otmb6yyaa Gebruikerbespreking:Maurese S. 3 2973 5444 2018-02-19T11:23:00Z KabouterBot 1931 Welkom! 5444 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:Jo-Jo Eumerus 3 2974 5445 2018-02-19T11:23:10Z KabouterBot 1931 Welkom! 5445 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:Раммон 3 2975 5446 2018-02-19T11:23:20Z KabouterBot 1931 Welkom! 5446 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:Gyrostat 3 2976 5447 2018-02-19T11:23:30Z KabouterBot 1931 Welkom! 5447 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:BlAgOjEaUbIn 3 2977 5448 2018-02-19T11:23:40Z KabouterBot 1931 Welkom! 5448 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:AmYnTaGaGe 3 2978 5449 2018-02-19T11:23:50Z KabouterBot 1931 Welkom! 5449 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:23, 19 Februarie 2018 (UTC) dhcs0frvj5aq1djwvp2c08e04dj0kci Gebruikerbespreking:Danvintius Bookix 3 2979 5450 2018-02-19T11:24:00Z KabouterBot 1931 Welkom! 5450 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:Murbaut 3 2980 5451 2018-02-19T11:24:10Z KabouterBot 1931 Welkom! 5451 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:Kjantjies 3 2981 5452 2018-02-19T11:24:20Z KabouterBot 1931 Welkom! 5452 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:BethNaught 3 2982 5453 2018-02-19T11:24:30Z KabouterBot 1931 Welkom! 5453 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:Nbfreeh 3 2983 5454 2018-02-19T11:24:40Z KabouterBot 1931 Welkom! 5454 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:Elop 3 2984 5455 2018-02-19T11:24:50Z KabouterBot 1931 Welkom! 5455 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:24, 19 Februarie 2018 (UTC) resqoev1uxul0ui228uc2jz3kwqr471 Gebruikerbespreking:NordNordWest 3 2985 5456 2018-02-19T11:25:00Z KabouterBot 1931 Welkom! 5456 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) 6pllrawu5b9yd25w78vxbhai2bgvcwu Gebruikerbespreking:Gestrid 3 2986 5457 2018-02-19T11:25:10Z KabouterBot 1931 Welkom! 5457 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) 6pllrawu5b9yd25w78vxbhai2bgvcwu Gebruikerbespreking:Offenbacherjung 3 2987 5458 2018-02-19T11:25:20Z KabouterBot 1931 Welkom! 5458 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) 6pllrawu5b9yd25w78vxbhai2bgvcwu Gebruikerbespreking:ElizeB0202 3 2988 5459 2018-02-19T11:25:30Z KabouterBot 1931 Welkom! 5459 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) 6pllrawu5b9yd25w78vxbhai2bgvcwu Gebruikerbespreking:Sänger 3 2989 5566 5460 2018-02-19T14:01:40Z Sänger 1748 /* Welkom */ ? 5566 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) :Beste Kabouter, waarom heb jij mij gewelkomt? [[Gebruiker:Sänger|Sänger]] ([[Gebruikerbespreking:Sänger|kontak]]) 14:01, 19 Februarie 2018 (UTC) ds3o5kj7xk5rhy5t4fkwhk5eyfr8lbn Gebruikerbespreking:SafetyCard 3 2990 5461 2018-02-19T11:25:50Z KabouterBot 1931 Welkom! 5461 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:25, 19 Februarie 2018 (UTC) 6pllrawu5b9yd25w78vxbhai2bgvcwu Gebruikerbespreking:Adavyd 3 2991 5462 2018-02-19T11:26:00Z KabouterBot 1931 Welkom! 5462 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:Francoisvorster10 3 2992 5463 2018-02-19T11:26:10Z KabouterBot 1931 Welkom! 5463 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:KSFT 3 2993 5464 2018-02-19T11:26:20Z KabouterBot 1931 Welkom! 5464 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:Runab WMF 3 2994 5465 2018-02-19T11:26:30Z KabouterBot 1931 Welkom! 5465 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:QZanden 3 2995 5466 2018-02-19T11:26:40Z KabouterBot 1931 Welkom! 5466 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:Constanstin 3 2996 5467 2018-02-19T11:26:50Z KabouterBot 1931 Welkom! 5467 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:26, 19 Februarie 2018 (UTC) bny0m7rwcwzf1flh5etg8n418w05nol Gebruikerbespreking:Martin Urbanec 3 2997 5468 2018-02-19T11:27:00Z KabouterBot 1931 Welkom! 5468 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Evgeny Kapun 3 2998 5469 2018-02-19T11:27:10Z KabouterBot 1931 Welkom! 5469 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Wernigruenenfelder 3 2999 5470 2018-02-19T11:27:20Z KabouterBot 1931 Welkom! 5470 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Orielno 3 3000 5471 2018-02-19T11:27:30Z KabouterBot 1931 Welkom! 5471 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Nickel nitride 3 3001 5472 2018-02-19T11:27:40Z KabouterBot 1931 Welkom! 5472 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Schirene 3 3002 5473 2018-02-19T11:27:50Z KabouterBot 1931 Welkom! 5473 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:27, 19 Februarie 2018 (UTC) 8ivaqn6dktin02ab1ne24hyuq1doxxi Gebruikerbespreking:Hhhggg 3 3003 5474 2018-02-19T11:28:00Z KabouterBot 1931 Welkom! 5474 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:Wiilliam principe 3 3004 5475 2018-02-19T11:28:10Z KabouterBot 1931 Welkom! 5475 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:Stang 3 3005 5476 2018-02-19T11:28:20Z KabouterBot 1931 Welkom! 5476 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:Gamliel Fishkin 3 3006 5477 2018-02-19T11:28:30Z KabouterBot 1931 Welkom! 5477 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:Ochilov 3 3007 5478 2018-02-19T11:28:40Z KabouterBot 1931 Welkom! 5478 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:Mixtrace 3 3008 5479 2018-02-19T11:28:50Z KabouterBot 1931 Welkom! 5479 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:28, 19 Februarie 2018 (UTC) 9smpcw5u05xhuu24kp7kze8vbypad4j Gebruikerbespreking:U14269 3 3009 5480 2018-02-19T11:29:00Z KabouterBot 1931 Welkom! 5480 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:Chaojoker 3 3010 5481 2018-02-19T11:29:10Z KabouterBot 1931 Welkom! 5481 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:AvatarTeam 3 3011 5482 2018-02-19T11:29:20Z KabouterBot 1931 Welkom! 5482 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:Eat me, I'm an azuki 3 3012 5483 2018-02-19T11:29:30Z KabouterBot 1931 Welkom! 5483 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:Bhaskaranaidu 3 3013 5484 2018-02-19T11:29:40Z KabouterBot 1931 Welkom! 5484 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:Zorbafilmes 3 3014 5485 2018-02-19T11:29:50Z KabouterBot 1931 Welkom! 5485 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:29, 19 Februarie 2018 (UTC) sr52bo0p998rvjjzftqmsvajh3gclcq Gebruikerbespreking:CreativeC 3 3015 5486 2018-02-19T11:30:00Z KabouterBot 1931 Welkom! 5486 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:Ayoub taouam 3 3016 5487 2018-02-19T11:30:10Z KabouterBot 1931 Welkom! 5487 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:Delecia malgas 3 3017 5488 2018-02-19T11:30:20Z KabouterBot 1931 Welkom! 5488 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:EROY 3 3018 5489 2018-02-19T11:30:30Z KabouterBot 1931 Welkom! 5489 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:2147483647 3 3019 5490 2018-02-19T11:30:40Z KabouterBot 1931 Welkom! 5490 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:Jonevanderwissel 3 3020 5491 2018-02-19T11:30:50Z KabouterBot 1931 Welkom! 5491 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:30, 19 Februarie 2018 (UTC) 5s4qdaxyzz1n8bleq38iby2694t8wdy Gebruikerbespreking:Envdmerwe 3 3021 5492 2018-02-19T11:31:00Z KabouterBot 1931 Welkom! 5492 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Kipala 3 3022 5493 2018-02-19T11:31:10Z KabouterBot 1931 Welkom! 5493 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Bill Prince Road 3 3023 5494 2018-02-19T11:31:20Z KabouterBot 1931 Welkom! 5494 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Paulswart 3 3024 5495 2018-02-19T11:31:30Z KabouterBot 1931 Welkom! 5495 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Esmalte Moniz 3 3025 5496 2018-02-19T11:31:40Z KabouterBot 1931 Welkom! 5496 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Willem smal 3 3026 5497 2018-02-19T11:31:50Z KabouterBot 1931 Welkom! 5497 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:31, 19 Februarie 2018 (UTC) q7cr35noeh9boz59jj3pc5lkweru2jz Gebruikerbespreking:Robin van der Vliet 3 3027 5498 2018-02-19T11:32:00Z KabouterBot 1931 Welkom! 5498 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:Stïnger 3 3028 5499 2018-02-19T11:32:10Z KabouterBot 1931 Welkom! 5499 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:AlvaroMolina 3 3029 5500 2018-02-19T11:32:20Z KabouterBot 1931 Welkom! 5500 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:ԱշոտՏՆՂ 3 3030 5501 2018-02-19T11:32:30Z KabouterBot 1931 Welkom! 5501 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:Pietrodn 3 3031 5502 2018-02-19T11:32:40Z KabouterBot 1931 Welkom! 5502 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:Winterysteppe 3 3032 5503 2018-02-19T11:32:50Z KabouterBot 1931 Welkom! 5503 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:32, 19 Februarie 2018 (UTC) 1srp0xg21mzuz716fjk4eptfnj6n75o Gebruikerbespreking:Francisco Fernando Smith 3 3033 5504 2018-02-19T11:33:00Z KabouterBot 1931 Welkom! 5504 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:Nontilz 3 3034 5505 2018-02-19T11:33:10Z KabouterBot 1931 Welkom! 5505 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:Titodutta 3 3035 5506 2018-02-19T11:33:20Z KabouterBot 1931 Welkom! 5506 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:GVarnum-WMF 3 3036 5507 2018-02-19T11:33:30Z KabouterBot 1931 Welkom! 5507 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:Euphydryas 3 3037 5508 2018-02-19T11:33:40Z KabouterBot 1931 Welkom! 5508 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:JohnWilliamDoe 3 3038 5509 2018-02-19T11:33:50Z KabouterBot 1931 Welkom! 5509 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:33, 19 Februarie 2018 (UTC) 5d19kujnlgycgm7vwhpegkpuheevtvr Gebruikerbespreking:Biplab Anand 3 3039 5510 2018-02-19T11:34:00Z KabouterBot 1931 Welkom! 5510 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:AYST201 3 3040 5511 2018-02-19T11:34:10Z KabouterBot 1931 Welkom! 5511 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:Quiddity (WMF) 3 3041 5512 2018-02-19T11:34:20Z KabouterBot 1931 Welkom! 5512 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:Cyberpower678 3 3042 5513 2018-02-19T11:34:30Z KabouterBot 1931 Welkom! 5513 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:BRPever 3 3043 5514 2018-02-19T11:34:40Z KabouterBot 1931 Welkom! 5514 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:Sevht 3 3044 7199 6828 2022-10-21T17:28:17Z QueerEcofeminist 2083 QueerEcofeminist het bladsy [[Gebruikerbespreking:Shinkiwa]] na [[Gebruikerbespreking:Sevht]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Shinkiwa|Shinkiwa]]" to "[[Special:CentralAuth/Sevht|Sevht]]" 5515 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:34, 19 Februarie 2018 (UTC) p4xri3htggm6ervekq2s8mng709etr0 Gebruikerbespreking:Cyndaquil 3 3045 5516 2018-02-19T11:35:00Z KabouterBot 1931 Welkom! 5516 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:Ridamerchant 3 3046 5517 2018-02-19T11:35:10Z KabouterBot 1931 Welkom! 5517 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:Jrko wrc 3 3047 5518 2018-02-19T11:35:20Z KabouterBot 1931 Welkom! 5518 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:Unprofesh 3 3048 5519 2018-02-19T11:35:30Z KabouterBot 1931 Welkom! 5519 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:NB-NB 3 3049 5520 2018-02-19T11:35:40Z KabouterBot 1931 Welkom! 5520 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:Pandakekok9 3 3050 6507 5521 2020-03-10T18:08:28Z Turkmen 2075 Turkmen het bladsy [[Gebruikerbespreking:Poyekhali]] na [[Gebruikerbespreking:Pandakekok9]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Poyekhali|Poyekhali]]" to "[[Special:CentralAuth/Pandakekok9|Pandakekok9]]" 5521 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:35, 19 Februarie 2018 (UTC) 8dnhxsf6im8jrvbh7wnugp3i50dezbg Gebruikerbespreking:ChittyBoomBox 3 3051 5522 2018-02-19T11:36:00Z KabouterBot 1931 Welkom! 5522 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:CloudEater 3 3052 5523 2018-02-19T11:36:10Z KabouterBot 1931 Welkom! 5523 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:SDJG 3 3053 5524 2018-02-19T11:36:20Z KabouterBot 1931 Welkom! 5524 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:ZOKIDIN 3 3054 5525 2018-02-19T11:36:30Z KabouterBot 1931 Welkom! 5525 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:Devraj poudel 3 3055 5526 2018-02-19T11:36:40Z KabouterBot 1931 Welkom! 5526 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:Zouhair bi 3 3056 5527 2018-02-19T11:36:50Z KabouterBot 1931 Welkom! 5527 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:36, 19 Februarie 2018 (UTC) 3i669817mz6witdd3ovb5afjpm5uag9 Gebruikerbespreking:Gradzeichen 3 3057 5528 2018-02-19T11:37:00Z KabouterBot 1931 Welkom! 5528 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Renier 3 3058 5529 2018-02-19T11:37:10Z KabouterBot 1931 Welkom! 5529 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Iskenderbalas 3 3059 5530 2018-02-19T11:37:20Z KabouterBot 1931 Welkom! 5530 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Wikiapicpp 3 3060 5531 2018-02-19T11:37:30Z KabouterBot 1931 Welkom! 5531 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Be More 3 3061 5532 2018-02-19T11:37:40Z KabouterBot 1931 Welkom! 5532 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Hawies 3 3062 5533 2018-02-19T11:37:50Z KabouterBot 1931 Welkom! 5533 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:37, 19 Februarie 2018 (UTC) 4d5m63257azafa2cvlx5arl9zqu6qaj Gebruikerbespreking:Mack Mezzy 3 3063 5534 2018-02-19T11:38:00Z KabouterBot 1931 Welkom! 5534 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 8q7r9t5kmqvzox9qifwrp3a2m8cccxo Gebruikerbespreking:TerraCodes 3 3064 5570 5535 2018-02-22T06:17:39Z TerraCodes 1670 thanks for the welcome~ 5570 wikitext text/x-wiki {{#babel:en|af-0}} == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 462ibubp8ltgzvwchr4h3ytrhkq88gp Gebruikerbespreking:Copyrightwin 3 3065 5536 2018-02-19T11:38:20Z KabouterBot 1931 Welkom! 5536 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 8q7r9t5kmqvzox9qifwrp3a2m8cccxo Gebruikerbespreking:Tcfc2349 3 3066 5537 2018-02-19T11:38:30Z KabouterBot 1931 Welkom! 5537 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 8q7r9t5kmqvzox9qifwrp3a2m8cccxo Gebruikerbespreking:Rachmat04 3 3067 5538 2018-02-19T11:38:40Z KabouterBot 1931 Welkom! 5538 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 8q7r9t5kmqvzox9qifwrp3a2m8cccxo Gebruikerbespreking:Lemmie 003 3 3068 5539 2018-02-19T11:38:50Z KabouterBot 1931 Welkom! 5539 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:38, 19 Februarie 2018 (UTC) 8q7r9t5kmqvzox9qifwrp3a2m8cccxo Gebruikerbespreking:Clear Sky C 3 3069 5540 2018-02-19T11:39:00Z KabouterBot 1931 Welkom! 5540 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:Iniquity 3 3070 5541 2018-02-19T11:39:10Z KabouterBot 1931 Welkom! 5541 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:Costa Mitendo Rastafarian 3 3071 5542 2018-02-19T11:39:20Z KabouterBot 1931 Welkom! 5542 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:° 3 3072 5543 2018-02-19T11:39:30Z KabouterBot 1931 Welkom! 5543 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:MASTERMATES 3 3073 5544 2018-02-19T11:39:40Z KabouterBot 1931 Welkom! 5544 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:Yurikoles 3 3074 5545 2018-02-19T11:39:50Z KabouterBot 1931 Welkom! 5545 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:39, 19 Februarie 2018 (UTC) a2nzg4nxj3pm2ebf35lhqaal0dcessl Gebruikerbespreking:Arturfrom 3 3075 5546 2018-02-19T11:40:00Z KabouterBot 1931 Welkom! 5546 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:Elaine Marais 3 3076 5547 2018-02-19T11:40:10Z KabouterBot 1931 Welkom! 5547 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:UY Scuti 3 3077 5548 2018-02-19T11:40:20Z KabouterBot 1931 Welkom! 5548 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:Fares usm 3 3078 5549 2018-02-19T11:40:30Z KabouterBot 1931 Welkom! 5549 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:Братья Стояловы (ДМ) 3 3079 5550 2018-02-19T11:40:40Z KabouterBot 1931 Welkom! 5550 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:LenovoTest01 3 3080 5551 2018-02-19T11:40:50Z KabouterBot 1931 Welkom! 5551 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:40, 19 Februarie 2018 (UTC) lnae5lwbz2d2hfeyz4907gv3a21ndtu Gebruikerbespreking:Cybularny 3 3081 5552 2018-02-19T11:41:00Z KabouterBot 1931 Welkom! 5552 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:Максим Підліснюк 3 3082 5553 2018-02-19T11:41:10Z KabouterBot 1931 Welkom! 5553 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:Zaviex 3 3083 5554 2018-02-19T11:41:20Z KabouterBot 1931 Welkom! 5554 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:永続繁栄 3 3084 5555 2018-02-19T11:41:30Z KabouterBot 1931 Welkom! 5555 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:三宅努 3 3085 5556 2018-02-19T11:41:40Z KabouterBot 1931 Welkom! 5556 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:NB80 3 3086 5557 2018-02-19T11:41:50Z KabouterBot 1931 Welkom! 5557 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:41, 19 Februarie 2018 (UTC) j62apx9sawt877tuv41bii47po8qq1u Gebruikerbespreking:Елена Генералов 3 3087 5558 2018-02-19T11:42:00Z KabouterBot 1931 Welkom! 5558 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Christian Hunter 3 3088 5559 2018-02-19T11:42:10Z KabouterBot 1931 Welkom! 5559 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Aries3003 3 3089 5560 2018-02-19T11:42:20Z KabouterBot 1931 Welkom! 5560 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Cycn 3 3090 5561 2018-02-19T11:42:30Z KabouterBot 1931 Welkom! 5561 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Dodekalinguaphoniker 3 3091 5562 2018-02-19T11:42:40Z KabouterBot 1931 Welkom! 5562 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Fouche Raath 3 3092 5563 2018-02-19T11:42:50Z KabouterBot 1931 Welkom! 5563 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:42, 19 Februarie 2018 (UTC) e30uabjcw1dmbyo15uuuezglpxbxbrg Gebruikerbespreking:Armbrust 3 3093 5564 2018-02-19T11:43:00Z KabouterBot 1931 Welkom! 5564 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:43, 19 Februarie 2018 (UTC) coax15dsh0zedp0vgux80bpqr10gmvk Gebruikerbespreking:Persino 3 3094 5565 2018-02-19T11:43:10Z KabouterBot 1931 Welkom! 5565 wikitext text/x-wiki == Welkom == '''Beste {{#Switch: {{{1}}}|PAGENAME={{{2}}}|{{PAGENAME}}}}''', [[Wikibooks:Welkom|welkom op Wikibooks!]] --[[Gebruiker:KabouterBot|KabouterBot]] ([[Gebruikerbespreking:KabouterBot|kontak]]) 11:43, 19 Februarie 2018 (UTC) coax15dsh0zedp0vgux80bpqr10gmvk Gebruikerbespreking:JJMC89 bot 3 3095 5568 2018-02-19T15:54:01Z JJMC89 1794 Create 5568 wikitext text/x-wiki __NOINDEX____NOEDITSECTION____NONEWSECTIONLINK__{{softredirect|meta:User talk:{{PAGENAME}}}} srx421gcshk3fa5tc0ag5px5380bkgx Gebruikerbespreking:Aftabuzzaman 3 3100 5589 2018-06-25T04:04:05Z Moheen 1968 Moheen Reeyad het bladsy [[Gebruikerbespreking:Aftabuzzaman]] na [[Gebruikerbespreking:আফতাবুজ্জামান]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Aftabuzzaman|Aftabuzzaman]]" to "[[Special:CentralAuth/আফতাবুজ্জামান|আফতাবুজ্জামান]]" 5589 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:আফতাবুজ্জামান]] nh7u5637qpib10wm2kkc0qx3wadc7oc Gebruiker:Polyglottos 2 3101 5590 2018-06-27T18:36:25Z Green Mostaza 955 {{bot}} 5590 wikitext text/x-wiki {{bot|Green Mostaza}} lbknyy06utkjizncf7f4oljdafhiwhk Gebruikerbespreking:Polyglottos 3 3102 5591 2018-06-27T18:37:08Z Green Mostaza 955 {{softredirect}} 5591 wikitext text/x-wiki {{softredirect|Gebruikerbespreking:Green Mostaza}} 6eku3gah1ho65i5rd9psejnogyhxf0d Gebruiker:Dualitas 2 3103 5592 2018-07-01T22:53:00Z Green Mostaza 955 {{bot}} 5592 wikitext text/x-wiki {{bot|Green Mostaza}} lbknyy06utkjizncf7f4oljdafhiwhk Gebruikerbespreking:Dualitas 3 3104 5593 2018-07-01T22:55:12Z Green Mostaza 955 {{softredirect}} 5593 wikitext text/x-wiki {{softredirect|Gebruikerbespreking:Green Mostaza}} 6eku3gah1ho65i5rd9psejnogyhxf0d Gebruiker:Vogone/minerva.js 2 3106 5597 2018-10-08T17:03:42Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Vogone]]) 5597 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:Vogone/minerva.js&action=raw&ctype=text/javascript'); e7qk639lldxvphqcoowl3nfc7i3anx7 Wikibooks:Gebruiker aanvra 4 3113 5609 2018-12-06T16:04:00Z 102.97.124.25 Fouad jabir 1234567890 5609 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruikerbespreking:五月雨恋歌 3 3115 5612 2018-12-16T04:01:52Z 1997kB 1873 1997kB het bladsy [[Gebruikerbespreking:五月雨恋歌]] na [[Gebruikerbespreking:夢蝶葬花]] oor 'n aanstuur geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/五月雨恋歌|五月雨恋歌]]" to "[[Special:CentralAuth/夢蝶葬花|夢蝶葬花]]" 5612 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:夢蝶葬花]] imndv2xzhwdldwllyrp6ivkvzjt0h6p Gebruikerbespreking:Bilbo40 3 3119 5620 2019-01-25T22:52:44Z Ejs-80 1564 Ejs-80 het bladsy [[Gebruikerbespreking:Bilbo40]] na [[Gebruikerbespreking:Luc Patin]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Bilbo40|Bilbo40]]" to "[[Special:CentralAuth/Luc Patin|Luc Patin]]" 5620 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Luc Patin]] gqs46j34huy6weaath56fxqykrkxvbx Gebruiker:Mentifisto 2 3123 5627 2019-03-02T21:56:35Z Stanglavine 1987 Stanglavine het bladsy [[Gebruiker:Mentifisto]] na [[Gebruiker:Lofty abyss]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Mentifisto|Mentifisto]]" to "[[Special:CentralAuth/Lofty abyss|Lofty abyss]]" 5627 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Lofty abyss]] b76jh5h3t4dmxh7905ubsaf9kr3hy70 Gebruikerbespreking:Tris T7 3 3124 5631 2019-05-14T17:00:50Z Tris T7 2063 added info 5631 wikitext text/x-wiki Hello This is Tris T7. I am from Thailand. If you want to talk or discuss about Wikis please do not hesitate to contact me for it. Thank you. Happy editing. Tris T7. qyb7hck8gg1wgqaibp0gy03vygn66ef Gebruikerbespreking:Ameisenigel 3 3129 7216 5724 2023-01-08T03:37:33Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Ameisenigel]]) 7216 wikitext text/x-wiki [[File:Redirect arrow without text.svg|46px|link=]][[m:User talk:Ameisenigel|m:User talk:Ameisenigel]] 2229pjupj4oxyrzx6wq7rucquxcn3pt Gebruiker:Waldir 2 3130 5643 2019-07-01T10:33:34Z 1997kB 1873 1997kB het bladsy [[Gebruiker:Waldir]] na [[Gebruiker:Waldyrious]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Waldir|Waldir]]" to "[[Special:CentralAuth/Waldyrious|Waldyrious]]" 5643 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Waldyrious]] mvfxhn7p9wj593yp1w0olva7mfs741q Gebruiker:محمد شعیب 2 3133 7387 5649 2024-05-24T00:12:21Z Vít Karásek 2642 double redirect 7387 wikitext text/x-wiki #AANSTUUR [[ur:User talk:محمد شعیب]] tdtxz5zghr2p9vkgntutaf3ivuqc2om Gebruikerbespreking:محمد شعیب 3 3134 7390 5650 2024-05-24T00:13:10Z Vít Karásek 2642 double redirect 7390 wikitext text/x-wiki #AANSTUUR [[ur:User talk:محمد شعیب]] tdtxz5zghr2p9vkgntutaf3ivuqc2om Gebruiker:FR30799386/minerva.js 2 3137 5660 2019-08-04T19:13:50Z Pathoschild 29 global user pages ([[m:Synchbot|requested by FR30799386]]) 5660 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:FR30799386/mobile-global.js&action=raw&ctype=text/javascript'); jpmcha1jgpe2b70kb7f5yx4h1ngdb91 Gebruikerbespreking:78.226.25.8 3 3138 5663 2019-08-19T07:51:21Z DARIO SEVERI 2068 Note of Quick Delete 5663 wikitext text/x-wiki ==[[Boekrak:Filosofie]]== Hello, thanks for your collaboration. I wanted to let you know that I deleted the page above because it is not written in this project's language, all text was in French. If you have any questions, you can leave me a message on my talk page. Thanks. [[Gebruiker:DARIO SEVERI|DARIO SEVERI]] ([[Gebruikerbespreking:DARIO SEVERI|kontak]]) 07:51, 19 Augustus 2019 (UTC) 1mho1v15z7g10guuik8zy142sa4iwa9 Gebruikerbespreking:WikiBayer 3 3139 5664 2019-09-14T15:21:26Z WikiBayer 2048 Nuwe bladsy geskep met '<div style="background-color:#00BFFF; border-radius:20px; text-align: center"><h1>Welcome on my User talk </h1></div>' 5664 wikitext text/x-wiki <div style="background-color:#00BFFF; border-radius:20px; text-align: center"><h1>Welcome on my User talk </h1></div> ecm5cj95pces8w1zcswhcejno4f8pvy Gebruiker:Chongkian 2 3140 5665 2019-09-30T03:29:02Z Chongkian 2108 Nuwe bladsy geskep met 'Hi everyone!' 5665 wikitext text/x-wiki Hi everyone! 0nzb19mczsfpeutkq7g2yvjk4b3b65u Gebruiker:Ainz Ooal Gown/minerva.js 2 3141 6761 5666 2020-07-11T04:16:52Z 1997kB 1873 1997kB het bladsy [[Gebruiker:Masumrezarock100/minerva.js]] na [[Gebruiker:Ainz Ooal Gown/minerva.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Masumrezarock100|Masumrezarock100]]" to "[[Special:CentralAuth/Ainz Ooal Gown|Ainz Ooal Gown]]" 5666 javascript text/javascript mw.loader.load('//meta.wikipedia.org/w/index.php?title=User:Masumrezarock100/global-minerva.js&action=raw&ctype=text/javascript'); // mobileGlobalJS to91va09kln5vco63egs1h2acqeuc5v Gebruikerbespreking:BukhariSaeed 3 3153 5720 2019-10-12T18:59:31Z علاء 1834 علاء het bladsy [[Gebruikerbespreking:BukhariSaeed]] na [[Gebruikerbespreking:Hammad]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/BukhariSaeed|BukhariSaeed]]" to "[[Special:CentralAuth/Hammad|Hammad]]" 5720 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Hammad]] exq2oqbpfopljqp27nbokhdoopkt1z0 Gebruikerbespreking:Killarnee 3 3155 5723 2019-11-18T23:21:10Z Killarnee 2124 Stuur aan na [[meta:User talk:Killarnee]] 5723 wikitext text/x-wiki #REDIRECT [[meta:User talk:Killarnee]] '''You can also write me here, but then it will probably take some time until I answer.''' 0j3i74n50fw0tbj8k6cj093zp81sx4w Gebruikerbespreking:Sewepb 3 3156 5725 2019-12-17T07:35:16Z Itti 2133 Itti het bladsy [[Gebruikerbespreking:Sewepb]] na [[Gebruikerbespreking:Ameisenigel]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Sewepb|Sewepb]]" to "[[Special:CentralAuth/Ameisenigel|Ameisenigel]]" 5725 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Ameisenigel]] eisgribnd027xsn427ewbiyygqds04i Gebruiker:WhitePhosphorus/minerva.js 2 3158 5727 2020-01-05T15:12:38Z Pathoschild 29 global user pages ([[m:Synchbot|requested by WhitePhosphorus]]) 5727 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:WhitePhosphorus/global-mobile.js&action=raw&ctype=text/javascript'); jxr0i4uppk1hrtb9t3ml1teg34o7lzp Gebruikerbespreking:Poyekhali 3 3295 6508 2020-03-10T18:08:28Z Turkmen 2075 Turkmen het bladsy [[Gebruikerbespreking:Poyekhali]] na [[Gebruikerbespreking:Pandakekok9]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Poyekhali|Poyekhali]]" to "[[Special:CentralAuth/Pandakekok9|Pandakekok9]]" 6508 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Pandakekok9]] 4du5fiyxt6cceqb5lhnxochre7drgnn Gebruiker:Leitoxx 2 3298 6519 2020-04-17T05:15:09Z Céréales Killer 1497 Céréales Killer het bladsy [[Gebruiker:Leitoxx]] na [[Gebruiker:Mazbel]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Leitoxx|Leitoxx]]" to "[[Special:CentralAuth/Mazbel|Mazbel]]" 6519 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Mazbel]] h00kfgjgj0wlutk69e63c52mjezzfz5 Sjabloon:U 10 3299 6521 6520 2020-04-28T07:31:08Z Раммон 1763 6521 wikitext text/x-wiki <includeonly>[[Gebruiker:{{{1|}}}|{{{2|{{{1|}}}}}}]]</includeonly><noinclude>{{doc}}</noinclude> dn33izmgyox5g67vi0ow2hqbfugkytl Sjabloon:Dokumentasie 10 3300 6530 6522 2020-04-28T08:18:15Z Раммон 1763 Раммон het bladsy [[Sjabloon:Doc]] na [[Sjabloon:Dokumentasie]] geskuif 6522 wikitext text/x-wiki {{#invoke:Dokumentasie|main|_content={{ {{#invoke:Dokumentasie|contentTitle}}}}}}<noinclude> <!-- Kategorieë gaan na die /doc subblad, en interwikis na Wikidata. --> </noinclude> oktgpig7bftaigu15n87kysl6t9se6a Module:Dokumentasie 828 3301 6523 2020-04-28T07:33:45Z Раммон 1763 Nuwe bladsy geskep met '-- This module implements {{documentation}}. -- Get required modules. local getArgs = require('Module:Arguments').getArgs local messageBox = require('Module:Message box'...' 6523 Scribunto text/plain -- This module implements {{documentation}}. -- Get required modules. local getArgs = require('Module:Arguments').getArgs local messageBox = require('Module:Message box') -- Get the config table. local cfg = mw.loadData('Module:Dokumentasie/config') local p = {} -- Often-used functions. local ugsub = mw.ustring.gsub ---------------------------------------------------------------------------- -- Helper functions -- -- These are defined as local functions, but are made available in the p -- table for testing purposes. ---------------------------------------------------------------------------- local function message(cfgKey, valArray, expectType) --[[ -- Gets a message from the cfg table and formats it if appropriate. -- The function raises an error if the value from the cfg table is not -- of the type expectType. The default type for expectType is 'string'. -- If the table valArray is present, strings such as $1, $2 etc. in the -- message are substituted with values from the table keys [1], [2] etc. -- For example, if the message "foo-message" had the value 'Foo $2 bar $1.', -- message('foo-message', {'baz', 'qux'}) would return "Foo qux bar baz." --]] local msg = cfg[cfgKey] expectType = expectType or 'string' if type(msg) ~= expectType then error('message: type error in message cfg.' .. cfgKey .. ' (' .. expectType .. ' expected, got ' .. type(msg) .. ')', 2) end if not valArray then return msg end local function getMessageVal(match) match = tonumber(match) return valArray[match] or error('message: no value found for key $' .. match .. ' in message cfg.' .. cfgKey, 4) end local ret = ugsub(msg, '$([1-9][0-9]*)', getMessageVal) return ret end p.message = message local function makeWikilink(page, display) if display then return mw.ustring.format('[[%s|%s]]', page, display) else return mw.ustring.format('[[%s]]', page) end end p.makeWikilink = makeWikilink local function makeCategoryLink(cat, sort) local catns = mw.site.namespaces[14].name return makeWikilink(catns .. ':' .. cat, sort) end p.makeCategoryLink = makeCategoryLink local function makeUrlLink(url, display) return mw.ustring.format('[%s %s]', url, display) end p.makeUrlLink = makeUrlLink local function makeToolbar(...) local ret = {} local lim = select('#', ...) if lim < 1 then return nil end for i = 1, lim do ret[#ret + 1] = select(i, ...) end return '<small style="font-style: normal;">(' .. table.concat(ret, ' &#124; ') .. ')</small>' end p.makeToolbar = makeToolbar ---------------------------------------------------------------------------- -- Argument processing ---------------------------------------------------------------------------- local function makeInvokeFunc(funcName) return function (frame) local args = getArgs(frame, { valueFunc = function (key, value) if type(value) == 'string' then value = value:match('^%s*(.-)%s*$') -- Remove whitespace. if key == 'heading' or value ~= '' then return value else return nil end else return value end end }) return p[funcName](args) end end ---------------------------------------------------------------------------- -- Main function ---------------------------------------------------------------------------- p.main = makeInvokeFunc('_main') function p._main(args) --[[ -- This function defines logic flow for the module. -- @args - table of arguments passed by the user -- -- Messages: -- 'main-div-id' --> 'template-documentation' -- 'main-div-classes' --> 'template-documentation iezoomfix' --]] local env = p.getEnvironment(args) local root = mw.html.create() root :wikitext(p.protectionTemplate(env)) :wikitext(p.sandboxNotice(args, env)) -- This div tag is from {{documentation/start box}}, but moving it here -- so that we don't have to worry about unclosed tags. :tag('div') :attr('id', message('main-div-id')) :addClass(message('main-div-classes')) :css('clear', 'both') :css('margin', '1em 0 0 0') :css('border', '1px solid #aaa') :css('background-color', '#ecfcf4') :css('padding', '1em') :newline() :wikitext(p._startBox(args, env)) :wikitext(p._content(args, env)) :tag('div') :css('clear', 'both') -- So right or left floating items don't stick out of the doc box. :newline() :done() :done() :wikitext(p._endBox(args, env)) :wikitext(p.addTrackingCategories(env)) return tostring(root) end ---------------------------------------------------------------------------- -- Environment settings ---------------------------------------------------------------------------- function p.getEnvironment(args) --[[ -- Returns a table with information about the environment, including title objects and other namespace- or -- path-related data. -- @args - table of arguments passed by the user -- -- Title objects include: -- env.title - the page we are making documentation for (usually the current title) -- env.templateTitle - the template (or module, file, etc.) -- env.docTitle - the /doc subpage. -- env.sandboxTitle - the /sandbox subpage. -- env.testcasesTitle - the /testcases subpage. -- env.printTitle - the print version of the template, located at the /Print subpage. -- -- Data includes: -- env.protectionLevels - the protection levels table of the title object. -- env.subjectSpace - the number of the title's subject namespace. -- env.docSpace - the number of the namespace the title puts its documentation in. -- env.docpageBase - the text of the base page of the /doc, /sandbox and /testcases pages, with namespace. -- env.compareUrl - URL of the Special:ComparePages page comparing the sandbox with the template. -- -- All table lookups are passed through pcall so that errors are caught. If an error occurs, the value -- returned will be nil. --]] local env, envFuncs = {}, {} -- Set up the metatable. If triggered we call the corresponding function in the envFuncs table. The value -- returned by that function is memoized in the env table so that we don't call any of the functions -- more than once. (Nils won't be memoized.) setmetatable(env, { __index = function (t, key) local envFunc = envFuncs[key] if envFunc then local success, val = pcall(envFunc) if success then env[key] = val -- Memoise the value. return val end end return nil end }) function envFuncs.title() -- The title object for the current page, or a test page passed with args.page. local title local titleArg = args.page if titleArg then title = mw.title.new(titleArg) else title = mw.title.getCurrentTitle() end return title end function envFuncs.templateTitle() --[[ -- The template (or module, etc.) title object. -- Messages: -- 'sandbox-subpage' --> 'sandbox' -- 'testcases-subpage' --> 'testcases' --]] local subjectSpace = env.subjectSpace local title = env.title local subpage = title.subpageText if subpage == message('sandbox-subpage') or subpage == message('testcases-subpage') then return mw.title.makeTitle(subjectSpace, title.baseText) else return mw.title.makeTitle(subjectSpace, title.text) end end function envFuncs.docTitle() --[[ -- Title object of the /doc subpage. -- Messages: -- 'doc-subpage' --> 'doc' --]] local title = env.title local docname = args[1] -- User-specified doc page. local docpage if docname then docpage = docname else docpage = env.docpageBase .. '/' .. message('doc-subpage') end return mw.title.new(docpage) end function envFuncs.sandboxTitle() --[[ -- Title object for the /sandbox subpage. -- Messages: -- 'sandbox-subpage' --> 'sandbox' --]] return mw.title.new(env.docpageBase .. '/' .. message('sandbox-subpage')) end function envFuncs.testcasesTitle() --[[ -- Title object for the /testcases subpage. -- Messages: -- 'testcases-subpage' --> 'testcases' --]] return mw.title.new(env.docpageBase .. '/' .. message('testcases-subpage')) end function envFuncs.printTitle() --[[ -- Title object for the /Print subpage. -- Messages: -- 'print-subpage' --> 'Print' --]] return env.templateTitle:subPageTitle(message('print-subpage')) end function envFuncs.protectionLevels() -- The protection levels table of the title object. return env.title.protectionLevels end function envFuncs.subjectSpace() -- The subject namespace number. return mw.site.namespaces[env.title.namespace].subject.id end function envFuncs.docSpace() -- The documentation namespace number. For most namespaces this is the same as the -- subject namespace. However, pages in the Article, File, MediaWiki or Category -- namespaces must have their /doc, /sandbox and /testcases pages in talk space. local subjectSpace = env.subjectSpace if subjectSpace == 0 or subjectSpace == 6 or subjectSpace == 8 or subjectSpace == 14 then return subjectSpace + 1 else return subjectSpace end end function envFuncs.docpageBase() -- The base page of the /doc, /sandbox, and /testcases subpages. -- For some namespaces this is the talk page, rather than the template page. local templateTitle = env.templateTitle local docSpace = env.docSpace local docSpaceText = mw.site.namespaces[docSpace].name -- Assemble the link. docSpace is never the main namespace, so we can hardcode the colon. return docSpaceText .. ':' .. templateTitle.text end function envFuncs.compareUrl() -- Diff link between the sandbox and the main template using [[Special:ComparePages]]. local templateTitle = env.templateTitle local sandboxTitle = env.sandboxTitle if templateTitle.exists and sandboxTitle.exists then local compareUrl = mw.uri.fullUrl( 'Special:ComparePages', {page1 = templateTitle.prefixedText, page2 = sandboxTitle.prefixedText} ) return tostring(compareUrl) else return nil end end return env end ---------------------------------------------------------------------------- -- Auxiliary templates ---------------------------------------------------------------------------- function p.sandboxNotice(args, env) --[=[ -- Generates a sandbox notice for display above sandbox pages. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'sandbox-notice-image' --> '[[Image:Sandbox.svg|50px|alt=|link=]]' -- 'sandbox-notice-blurb' --> 'This is the $1 for $2.' -- 'sandbox-notice-diff-blurb' --> 'This is the $1 for $2 ($3).' -- 'sandbox-notice-pagetype-template' --> '[[Wikipedia:Template test cases|template sandbox]] page' -- 'sandbox-notice-pagetype-module' --> '[[Wikipedia:Template test cases|module sandbox]] page' -- 'sandbox-notice-pagetype-other' --> 'sandbox page' -- 'sandbox-notice-compare-link-display' --> 'diff' -- 'sandbox-notice-testcases-blurb' --> 'See also the companion subpage for $1.' -- 'sandbox-notice-testcases-link-display' --> 'test cases' -- 'sandbox-category' --> 'Template sandboxes' --]=] local title = env.title local sandboxTitle = env.sandboxTitle local templateTitle = env.templateTitle local subjectSpace = env.subjectSpace if not (subjectSpace and title and sandboxTitle and templateTitle and mw.title.equals(title, sandboxTitle)) then return nil end -- Build the table of arguments to pass to {{ombox}}. We need just two fields, "image" and "text". local omargs = {} omargs.image = message('sandbox-notice-image') -- Get the text. We start with the opening blurb, which is something like -- "This is the template sandbox for [[Template:Foo]] (diff)." local text = '' local frame = mw.getCurrentFrame() local isPreviewing = frame:preprocess('{{REVISIONID}}') == '' -- True if the page is being previewed. local pagetype if subjectSpace == 10 then pagetype = message('sandbox-notice-pagetype-template') elseif subjectSpace == 828 then pagetype = message('sandbox-notice-pagetype-module') else pagetype = message('sandbox-notice-pagetype-other') end local templateLink = makeWikilink(templateTitle.prefixedText) local compareUrl = env.compareUrl if isPreviewing or not compareUrl then text = text .. message('sandbox-notice-blurb', {pagetype, templateLink}) else local compareDisplay = message('sandbox-notice-compare-link-display') local compareLink = makeUrlLink(compareUrl, compareDisplay) text = text .. message('sandbox-notice-diff-blurb', {pagetype, templateLink, compareLink}) end -- Get the test cases page blurb if the page exists. This is something like -- "See also the companion subpage for [[Template:Foo/testcases|test cases]]." local testcasesTitle = env.testcasesTitle if testcasesTitle and testcasesTitle.exists then if testcasesTitle.namespace == mw.site.namespaces.Module.id then local testcasesLinkDisplay = message('sandbox-notice-testcases-link-display') local testcasesRunLinkDisplay = message('sandbox-notice-testcases-run-link-display') local testcasesLink = makeWikilink(testcasesTitle.prefixedText, testcasesLinkDisplay) local testcasesRunLink = makeWikilink(testcasesTitle.talkPageTitle.prefixedText, testcasesRunLinkDisplay) text = text .. '<br />' .. message('sandbox-notice-testcases-run-blurb', {testcasesLink, testcasesRunLink}) else local testcasesLinkDisplay = message('sandbox-notice-testcases-link-display') local testcasesLink = makeWikilink(testcasesTitle.prefixedText, testcasesLinkDisplay) text = text .. '<br />' .. message('sandbox-notice-testcases-blurb', {testcasesLink}) end end -- Add the sandbox to the sandbox category. text = text .. makeCategoryLink(message('sandbox-category')) omargs.text = text local ret = '<div style="clear: both;"></div>' ret = ret .. messageBox.main('ombox', omargs) return ret end function p.protectionTemplate(env) -- Generates the padlock icon in the top right. -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- Messages: -- 'protection-template' --> 'pp-template' -- 'protection-template-args' --> {docusage = 'yes'} local protectionLevels, mProtectionBanner local title = env.title -- Wawiel: op die oomblik is daar goggas hier wat eers reggemaak moet word. Beskermde sjablone se dokumentasie wil nie genereer nie. return nil --protectionLevels = env.protectionLevels --if not protectionLevels then -- return nil --end --local editProt = protectionLevels.edit and protectionLevels.edit[1] --local moveProt = protectionLevels.move and protectionLevels.move[1] --if editProt then -- -- The page is edit-protected. -- mProtectionBanner = require('Module:Protection banner') -- local reason = message('protection-reason-edit') -- return mProtectionBanner._main{reason, small = true} --elseif moveProt and moveProt ~= 'autoconfirmed' then -- -- The page is move-protected but not edit-protected. Exclude move -- -- protection with the level "autoconfirmed", as this is equivalent to -- -- no move protection at all. -- mProtectionBanner = require('Module:Protection banner') -- return mProtectionBanner._main{action = 'move', small = true} --else -- return nil --end end ---------------------------------------------------------------------------- -- Start box ---------------------------------------------------------------------------- p.startBox = makeInvokeFunc('_startBox') function p._startBox(args, env) --[[ -- This function generates the start box. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- The actual work is done by p.makeStartBoxLinksData and p.renderStartBoxLinks which make -- the [view] [edit] [history] [purge] links, and by p.makeStartBoxData and p.renderStartBox -- which generate the box HTML. --]] env = env or p.getEnvironment(args) local links local content = args.content if not content then -- No need to include the links if the documentation is on the template page itself. local linksData = p.makeStartBoxLinksData(args, env) if linksData then links = p.renderStartBoxLinks(linksData) end end -- Generate the start box html. local data = p.makeStartBoxData(args, env, links) if data then return p.renderStartBox(data) else -- User specified no heading. return nil end end function p.makeStartBoxLinksData(args, env) --[[ -- Does initial processing of data to make the [view] [edit] [history] [purge] links. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'view-link-display' --> 'view' -- 'edit-link-display' --> 'edit' -- 'history-link-display' --> 'history' -- 'purge-link-display' --> 'purge' -- 'file-docpage-preload' --> 'Template:Documentation/preload-filespace' -- 'module-preload' --> 'Template:Documentation/preload-module-doc' -- 'docpage-preload' --> 'Template:Documentation/preload' -- 'create-link-display' --> 'create' --]] local subjectSpace = env.subjectSpace local title = env.title local docTitle = env.docTitle if not title or not docTitle then return nil end local data = {} data.title = title data.docTitle = docTitle -- View, display, edit, and purge links if /doc exists. data.viewLinkDisplay = message('view-link-display') data.editLinkDisplay = message('edit-link-display') data.historyLinkDisplay = message('history-link-display') data.purgeLinkDisplay = message('purge-link-display') -- Create link if /doc doesn't exist. local preload = args.preload if not preload then if subjectSpace == 6 then -- File namespace preload = message('file-docpage-preload') elseif subjectSpace == 828 then -- Module namespace preload = message('module-preload') else preload = message('docpage-preload') end end data.preload = preload data.createLinkDisplay = message('create-link-display') return data end function p.renderStartBoxLinks(data) --[[ -- Generates the [view][edit][history][purge] or [create] links from the data table. -- @data - a table of data generated by p.makeStartBoxLinksData --]] local function escapeBrackets(s) -- Escapes square brackets with HTML entities. s = s:gsub('%[', '&#91;') -- Replace square brackets with HTML entities. s = s:gsub('%]', '&#93;') return s end local ret local docTitle = data.docTitle local title = data.title if docTitle.exists then local viewLink = makeWikilink(docTitle.prefixedText, data.viewLinkDisplay) local editLink = makeUrlLink(docTitle:fullUrl{action = 'edit'}, data.editLinkDisplay) local historyLink = makeUrlLink(docTitle:fullUrl{action = 'history'}, data.historyLinkDisplay) local purgeLink = makeUrlLink(title:fullUrl{action = 'purge'}, data.purgeLinkDisplay) ret = '[%s] [%s] [%s] [%s]' ret = escapeBrackets(ret) ret = mw.ustring.format(ret, viewLink, editLink, historyLink, purgeLink) else local createLink = makeUrlLink(docTitle:fullUrl{action = 'edit', preload = data.preload}, data.createLinkDisplay) ret = '[%s]' ret = escapeBrackets(ret) ret = mw.ustring.format(ret, createLink) end return ret end function p.makeStartBoxData(args, env, links) --[=[ -- Does initial processing of data to pass to the start-box render function, p.renderStartBox. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- @links - a string containing the [view][edit][history][purge] links - could be nil if there's an error. -- -- Messages: -- 'documentation-icon-wikitext' --> '[[File:Test Template Info-Icon - Version (2).svg|50px|link=|alt=Documentation icon]]' -- 'template-namespace-heading' --> 'Template documentation' -- 'module-namespace-heading' --> 'Module documentation' -- 'file-namespace-heading' --> 'Summary' -- 'other-namespaces-heading' --> 'Documentation' -- 'start-box-linkclasses' --> 'mw-editsection-like plainlinks' -- 'start-box-link-id' --> 'doc_editlinks' -- 'testcases-create-link-display' --> 'create' --]=] local subjectSpace = env.subjectSpace if not subjectSpace then -- Default to an "other namespaces" namespace, so that we get at least some output -- if an error occurs. subjectSpace = 2 end local data = {} -- Heading local heading = args.heading -- Blank values are not removed. if heading == '' then -- Don't display the start box if the heading arg is defined but blank. return nil end if heading then data.heading = heading elseif subjectSpace == 10 then -- Template namespace data.heading = message('documentation-icon-wikitext') .. ' ' .. message('template-namespace-heading') elseif subjectSpace == 828 then -- Module namespace data.heading = message('documentation-icon-wikitext') .. ' ' .. message('module-namespace-heading') elseif subjectSpace == 6 then -- File namespace data.heading = message('file-namespace-heading') else data.heading = message('other-namespaces-heading') end -- Heading CSS local headingStyle = args['heading-style'] if headingStyle then data.headingStyleText = headingStyle elseif subjectSpace == 10 then -- We are in the template or template talk namespaces. data.headingFontWeight = 'bold' data.headingFontSize = '125%' else data.headingFontSize = '150%' end -- Data for the [view][edit][history][purge] or [create] links. if links then data.linksClass = message('start-box-linkclasses') data.linksId = message('start-box-link-id') data.links = links end return data end function p.renderStartBox(data) -- Renders the start box html. -- @data - a table of data generated by p.makeStartBoxData. local sbox = mw.html.create('div') sbox :css('padding-bottom', '3px') :css('border-bottom', '1px solid #aaa') :css('margin-bottom', '1ex') :newline() :tag('span') :cssText(data.headingStyleText) :css('font-weight', data.headingFontWeight) :css('font-size', data.headingFontSize) :wikitext(data.heading) local links = data.links if links then sbox:tag('span') :addClass(data.linksClass) :attr('id', data.linksId) :wikitext(links) end return tostring(sbox) end ---------------------------------------------------------------------------- -- Documentation content ---------------------------------------------------------------------------- p.content = makeInvokeFunc('_content') function p._content(args, env) -- Displays the documentation contents -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment env = env or p.getEnvironment(args) local docTitle = env.docTitle local content = args.content if not content and docTitle and docTitle.exists then content = args._content or mw.getCurrentFrame():expandTemplate{title = docTitle.prefixedText} end -- The line breaks below are necessary so that "=== Headings ===" at the start and end -- of docs are interpreted correctly. return '\n' .. (content or '') .. '\n' end p.contentTitle = makeInvokeFunc('_contentTitle') function p._contentTitle(args, env) env = env or p.getEnvironment(args) local docTitle = env.docTitle if not args.content and docTitle and docTitle.exists then return docTitle.prefixedText else return '' end end ---------------------------------------------------------------------------- -- End box ---------------------------------------------------------------------------- p.endBox = makeInvokeFunc('_endBox') function p._endBox(args, env) --[=[ -- This function generates the end box (also known as the link box). -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'fmbox-id' --> 'documentation-meta-data' -- 'fmbox-style' --> 'background-color: #ecfcf4' -- 'fmbox-textstyle' --> 'font-style: italic' -- -- The HTML is generated by the {{fmbox}} template, courtesy of [[Module:Message box]]. --]=] -- Get environment data. env = env or p.getEnvironment(args) local subjectSpace = env.subjectSpace local docTitle = env.docTitle if not subjectSpace or not docTitle then return nil end -- Check whether we should output the end box at all. Add the end -- box by default if the documentation exists or if we are in the -- user, module or template namespaces. local linkBox = args['link box'] if linkBox == 'off' or not ( docTitle.exists or subjectSpace == 2 or subjectSpace == 828 or subjectSpace == 10 ) then return nil end -- Assemble the arguments for {{fmbox}}. local fmargs = {} fmargs.id = message('fmbox-id') -- Sets 'documentation-meta-data' fmargs.image = 'none' fmargs.style = message('fmbox-style') -- Sets 'background-color: #ecfcf4' fmargs.textstyle = message('fmbox-textstyle') -- 'font-style: italic;' -- Assemble the fmbox text field. local text = '' if linkBox then text = text .. linkBox else text = text .. (p.makeDocPageBlurb(args, env) or '') -- "This documentation is transcluded from [[Foo]]." if subjectSpace == 2 or subjectSpace == 10 or subjectSpace == 828 then -- We are in the user, template or module namespaces. -- Add sandbox and testcases links. -- "Editors can experiment in this template's sandbox and testcases pages." text = text .. (p.makeExperimentBlurb(args, env) or '') text = text .. '<br />' if not args.content and not args[1] then -- "Please add categories to the /doc subpage." -- Don't show this message with inline docs or with an explicitly specified doc page, -- as then it is unclear where to add the categories. text = text .. (p.makeCategoriesBlurb(args, env) or '') end text = text .. ' ' .. (p.makeSubpagesBlurb(args, env) or '') --"Subpages of this template" local printBlurb = p.makePrintBlurb(args, env) -- Two-line blurb about print versions of templates. if printBlurb then text = text .. '<br />' .. printBlurb end end end fmargs.text = text return messageBox.main('fmbox', fmargs) end function p.makeDocPageBlurb(args, env) --[=[ -- Makes the blurb "This documentation is transcluded from [[Template:Foo]] (edit, history)". -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'edit-link-display' --> 'edit' -- 'history-link-display' --> 'history' -- 'transcluded-from-blurb' --> -- 'The above [[Wikipedia:Template documentation|documentation]] -- is [[Wikipedia:Transclusion|transcluded]] from $1.' -- 'module-preload' --> 'Template:Documentation/preload-module-doc' -- 'create-link-display' --> 'create' -- 'create-module-doc-blurb' --> -- 'You might want to $1 a documentation page for this [[Wikipedia:Lua|Scribunto module]].' --]=] local docTitle = env.docTitle if not docTitle then return nil end local ret if docTitle.exists then -- /doc exists; link to it. local docLink = makeWikilink(docTitle.prefixedText) local editUrl = docTitle:fullUrl{action = 'edit'} local editDisplay = message('edit-link-display') local editLink = makeUrlLink(editUrl, editDisplay) local historyUrl = docTitle:fullUrl{action = 'history'} local historyDisplay = message('history-link-display') local historyLink = makeUrlLink(historyUrl, historyDisplay) ret = message('transcluded-from-blurb', {docLink}) .. ' ' .. makeToolbar(editLink, historyLink) .. '<br />' elseif env.subjectSpace == 828 then -- /doc does not exist; ask to create it. local createUrl = docTitle:fullUrl{action = 'edit', preload = message('module-preload')} local createDisplay = message('create-link-display') local createLink = makeUrlLink(createUrl, createDisplay) ret = message('create-module-doc-blurb', {createLink}) .. '<br />' end return ret end function p.makeExperimentBlurb(args, env) --[[ -- Renders the text "Editors can experiment in this template's sandbox (edit | diff) and testcases (edit) pages." -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'sandbox-link-display' --> 'sandbox' -- 'sandbox-edit-link-display' --> 'edit' -- 'compare-link-display' --> 'diff' -- 'module-sandbox-preload' --> 'Template:Documentation/preload-module-sandbox' -- 'template-sandbox-preload' --> 'Template:Documentation/preload-sandbox' -- 'sandbox-create-link-display' --> 'create' -- 'mirror-edit-summary' --> 'Create sandbox version of $1' -- 'mirror-link-display' --> 'mirror' -- 'mirror-link-preload' --> 'Template:Documentation/mirror' -- 'sandbox-link-display' --> 'sandbox' -- 'testcases-link-display' --> 'testcases' -- 'testcases-edit-link-display'--> 'edit' -- 'template-sandbox-preload' --> 'Template:Documentation/preload-sandbox' -- 'testcases-create-link-display' --> 'create' -- 'testcases-link-display' --> 'testcases' -- 'testcases-edit-link-display' --> 'edit' -- 'module-testcases-preload' --> 'Template:Documentation/preload-module-testcases' -- 'template-testcases-preload' --> 'Template:Documentation/preload-testcases' -- 'experiment-blurb-module' --> 'Editors can experiment in this module's $1 and $2 pages.' -- 'experiment-blurb-template' --> 'Editors can experiment in this template's $1 and $2 pages.' --]] local subjectSpace = env.subjectSpace local templateTitle = env.templateTitle local sandboxTitle = env.sandboxTitle local testcasesTitle = env.testcasesTitle local templatePage = templateTitle.prefixedText if not subjectSpace or not templateTitle or not sandboxTitle or not testcasesTitle then return nil end -- Make links. local sandboxLinks, testcasesLinks if sandboxTitle.exists then local sandboxPage = sandboxTitle.prefixedText local sandboxDisplay = message('sandbox-link-display') local sandboxLink = makeWikilink(sandboxPage, sandboxDisplay) local sandboxEditUrl = sandboxTitle:fullUrl{action = 'edit'} local sandboxEditDisplay = message('sandbox-edit-link-display') local sandboxEditLink = makeUrlLink(sandboxEditUrl, sandboxEditDisplay) local compareUrl = env.compareUrl local compareLink if compareUrl then local compareDisplay = message('compare-link-display') compareLink = makeUrlLink(compareUrl, compareDisplay) end sandboxLinks = sandboxLink .. ' ' .. makeToolbar(sandboxEditLink, compareLink) else local sandboxPreload if subjectSpace == 828 then sandboxPreload = message('module-sandbox-preload') else sandboxPreload = message('template-sandbox-preload') end local sandboxCreateUrl = sandboxTitle:fullUrl{action = 'edit', preload = sandboxPreload} local sandboxCreateDisplay = message('sandbox-create-link-display') local sandboxCreateLink = makeUrlLink(sandboxCreateUrl, sandboxCreateDisplay) local mirrorSummary = message('mirror-edit-summary', {makeWikilink(templatePage)}) local mirrorPreload = message('mirror-link-preload') local mirrorUrl = sandboxTitle:fullUrl{action = 'edit', preload = mirrorPreload, summary = mirrorSummary} local mirrorDisplay = message('mirror-link-display') local mirrorLink = makeUrlLink(mirrorUrl, mirrorDisplay) sandboxLinks = message('sandbox-link-display') .. ' ' .. makeToolbar(sandboxCreateLink, mirrorLink) end if testcasesTitle and testcasesTitle.exists then local testcasesPage = testcasesTitle.prefixedText local testcasesDisplay = message('testcases-link-display') local testcasesLink = makeWikilink(testcasesPage, testcasesDisplay) local testcasesEditUrl = testcasesTitle:fullUrl{action = 'edit'} local testcasesEditDisplay = message('testcases-edit-link-display') local testcasesEditLink = makeUrlLink(testcasesEditUrl, testcasesEditDisplay) -- for Modules, add testcases run link if exists if subjectSpace == 828 and testcasesTitle.talkPageTitle and testcasesTitle.talkPageTitle.exists then local testcasesRunLinkDisplay = message('testcases-run-link-display') local testcasesRunLink = makeWikilink(testcasesTitle.talkPageTitle.prefixedText, testcasesRunLinkDisplay) testcasesLinks = testcasesLink .. ' ' .. makeToolbar(testcasesEditLink, testcasesRunLink) else testcasesLinks = testcasesLink .. ' ' .. makeToolbar(testcasesEditLink) end else local testcasesPreload if subjectSpace == 828 then testcasesPreload = message('module-testcases-preload') else testcasesPreload = message('template-testcases-preload') end local testcasesCreateUrl = testcasesTitle:fullUrl{action = 'edit', preload = testcasesPreload} local testcasesCreateDisplay = message('testcases-create-link-display') local testcasesCreateLink = makeUrlLink(testcasesCreateUrl, testcasesCreateDisplay) testcasesLinks = message('testcases-link-display') .. ' ' .. makeToolbar(testcasesCreateLink) end local messageName if subjectSpace == 828 then messageName = 'experiment-blurb-module' else messageName = 'experiment-blurb-template' end return message(messageName, {sandboxLinks, testcasesLinks}) end function p.makeCategoriesBlurb(args, env) --[[ -- Generates the text "Please add categories to the /doc subpage." -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- Messages: -- 'doc-link-display' --> '/doc' -- 'add-categories-blurb' --> 'Please add categories to the $1 subpage.' --]] local docTitle = env.docTitle if not docTitle then return nil end local docPathLink = makeWikilink(docTitle.prefixedText, message('doc-link-display')) return message('add-categories-blurb', {docPathLink}) end function p.makeSubpagesBlurb(args, env) --[[ -- Generates the "Subpages of this template" link. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- Messages: -- 'template-pagetype' --> 'template' -- 'module-pagetype' --> 'module' -- 'default-pagetype' --> 'page' -- 'subpages-link-display' --> 'Subpages of this $1' --]] local subjectSpace = env.subjectSpace local templateTitle = env.templateTitle if not subjectSpace or not templateTitle then return nil end local pagetype if subjectSpace == 10 then pagetype = message('template-pagetype') elseif subjectSpace == 828 then pagetype = message('module-pagetype') else pagetype = message('default-pagetype') end local subpagesLink = makeWikilink( 'Special:PrefixIndex/' .. templateTitle.prefixedText .. '/', message('subpages-link-display', {pagetype}) ) return message('subpages-blurb', {subpagesLink}) end function p.makePrintBlurb(args, env) --[=[ -- Generates the blurb displayed when there is a print version of the template available. -- @args - a table of arguments passed by the user -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- -- Messages: -- 'print-link-display' --> '/Print' -- 'print-blurb' --> 'A [[Help:Books/for experts#Improving the book layout|print version]]' -- .. ' of this template exists at $1.' -- .. ' If you make a change to this template, please update the print version as well.' -- 'display-print-category' --> true -- 'print-category' --> 'Templates with print versions' --]=] local printTitle = env.printTitle if not printTitle then return nil end local ret if printTitle.exists then local printLink = makeWikilink(printTitle.prefixedText, message('print-link-display')) ret = message('print-blurb', {printLink}) local displayPrintCategory = message('display-print-category', nil, 'boolean') if displayPrintCategory then ret = ret .. makeCategoryLink(message('print-category')) end end return ret end ---------------------------------------------------------------------------- -- Tracking categories ---------------------------------------------------------------------------- function p.addTrackingCategories(env) --[[ -- Check if {{documentation}} is transcluded on a /doc or /testcases page. -- @env - environment table containing title objects, etc., generated with p.getEnvironment -- Messages: -- 'display-strange-usage-category' --> true -- 'doc-subpage' --> 'doc' -- 'testcases-subpage' --> 'testcases' -- 'strange-usage-category' --> 'Wikipedia pages with strange ((documentation)) usage' -- -- /testcases pages in the module namespace are not categorised, as they may have -- {{documentation}} transcluded automatically. --]] local title = env.title local subjectSpace = env.subjectSpace if not title or not subjectSpace then return nil end local subpage = title.subpageText local ret = '' if message('display-strange-usage-category', nil, 'boolean') and ( subpage == message('doc-subpage') or subjectSpace ~= 828 and subpage == message('testcases-subpage') ) then ret = ret .. makeCategoryLink(message('strange-usage-category')) end return ret end return p qh6nus2l8mym1o9i6ztyruc97ta506l Module:Arguments 828 3302 6524 2020-04-28T07:35:33Z Раммон 1763 Nuwe bladsy geskep met '-- This module provides easy processing of arguments passed to Scribunto from -- #invoke. It is intended for use by other Lua modules, and should not be -- called from #i...' 6524 Scribunto text/plain -- This module provides easy processing of arguments passed to Scribunto from -- #invoke. It is intended for use by other Lua modules, and should not be -- called from #invoke directly. local libraryUtil = require('libraryUtil') local checkType = libraryUtil.checkType local arguments = {} -- Generate four different tidyVal functions, so that we don't have to check the -- options every time we call it. local function tidyValDefault(key, val) if type(val) == 'string' then val = val:match('^%s*(.-)%s*$') if val == '' then return nil else return val end else return val end end local function tidyValTrimOnly(key, val) if type(val) == 'string' then return val:match('^%s*(.-)%s*$') else return val end end local function tidyValRemoveBlanksOnly(key, val) if type(val) == 'string' then if val:find('%S') then return val else return nil end else return val end end local function tidyValNoChange(key, val) return val end local function matchesTitle(given, title) local tp = type( given ) return (tp == 'string' or tp == 'number') and mw.title.new( given ).prefixedText == title end local translate_mt = { __index = function(t, k) return k end } function arguments.getArgs(frame, options) checkType('getArgs', 1, frame, 'table', true) checkType('getArgs', 2, options, 'table', true) frame = frame or {} options = options or {} --[[ -- Set up argument translation. --]] options.translate = options.translate or {} if getmetatable(options.translate) == nil then setmetatable(options.translate, translate_mt) end if options.backtranslate == nil then options.backtranslate = {} for k,v in pairs(options.translate) do options.backtranslate[v] = k end end if options.backtranslate and getmetatable(options.backtranslate) == nil then setmetatable(options.backtranslate, { __index = function(t, k) if options.translate[k] ~= k then return nil else return k end end }) end --[[ -- Get the argument tables. If we were passed a valid frame object, get the -- frame arguments (fargs) and the parent frame arguments (pargs), depending -- on the options set and on the parent frame's availability. If we weren't -- passed a valid frame object, we are being called from another Lua module -- or from the debug console, so assume that we were passed a table of args -- directly, and assign it to a new variable (luaArgs). --]] local fargs, pargs, luaArgs if type(frame.args) == 'table' and type(frame.getParent) == 'function' then if options.wrappers then --[[ -- The wrappers option makes Module:Arguments look up arguments in -- either the frame argument table or the parent argument table, but -- not both. This means that users can use either the #invoke syntax -- or a wrapper template without the loss of performance associated -- with looking arguments up in both the frame and the parent frame. -- Module:Arguments will look up arguments in the parent frame -- if it finds the parent frame's title in options.wrapper; -- otherwise it will look up arguments in the frame object passed -- to getArgs. --]] local parent = frame:getParent() if not parent then fargs = frame.args else local title = parent:getTitle():gsub('/sandbox$', '') local found = false if matchesTitle(options.wrappers, title) then found = true elseif type(options.wrappers) == 'table' then for _,v in pairs(options.wrappers) do if matchesTitle(v, title) then found = true break end end end -- We test for false specifically here so that nil (the default) acts like true. if found or options.frameOnly == false then pargs = parent.args end if not found or options.parentOnly == false then fargs = frame.args end end else -- options.wrapper isn't set, so check the other options. if not options.parentOnly then fargs = frame.args end if not options.frameOnly then local parent = frame:getParent() pargs = parent and parent.args or nil end end if options.parentFirst then fargs, pargs = pargs, fargs end else luaArgs = frame end -- Set the order of precedence of the argument tables. If the variables are -- nil, nothing will be added to the table, which is how we avoid clashes -- between the frame/parent args and the Lua args. local argTables = {fargs} argTables[#argTables + 1] = pargs argTables[#argTables + 1] = luaArgs --[[ -- Generate the tidyVal function. If it has been specified by the user, we -- use that; if not, we choose one of four functions depending on the -- options chosen. This is so that we don't have to call the options table -- every time the function is called. --]] local tidyVal = options.valueFunc if tidyVal then if type(tidyVal) ~= 'function' then error( "bad value assigned to option 'valueFunc'" .. '(function expected, got ' .. type(tidyVal) .. ')', 2 ) end elseif options.trim ~= false then if options.removeBlanks ~= false then tidyVal = tidyValDefault else tidyVal = tidyValTrimOnly end else if options.removeBlanks ~= false then tidyVal = tidyValRemoveBlanksOnly else tidyVal = tidyValNoChange end end --[[ -- Set up the args, metaArgs and nilArgs tables. args will be the one -- accessed from functions, and metaArgs will hold the actual arguments. Nil -- arguments are memoized in nilArgs, and the metatable connects all of them -- together. --]] local args, metaArgs, nilArgs, metatable = {}, {}, {}, {} setmetatable(args, metatable) local function mergeArgs(tables) --[[ -- Accepts multiple tables as input and merges their keys and values -- into one table. If a value is already present it is not overwritten; -- tables listed earlier have precedence. We are also memoizing nil -- values, which can be overwritten if they are 's' (soft). --]] for _, t in ipairs(tables) do for key, val in pairs(t) do if metaArgs[key] == nil and nilArgs[key] ~= 'h' then local tidiedVal = tidyVal(key, val) if tidiedVal == nil then nilArgs[key] = 's' else metaArgs[key] = tidiedVal end end end end end --[[ -- Define metatable behaviour. Arguments are memoized in the metaArgs table, -- and are only fetched from the argument tables once. Fetching arguments -- from the argument tables is the most resource-intensive step in this -- module, so we try and avoid it where possible. For this reason, nil -- arguments are also memoized, in the nilArgs table. Also, we keep a record -- in the metatable of when pairs and ipairs have been called, so we do not -- run pairs and ipairs on the argument tables more than once. We also do -- not run ipairs on fargs and pargs if pairs has already been run, as all -- the arguments will already have been copied over. --]] metatable.__index = function (t, key) --[[ -- Fetches an argument when the args table is indexed. First we check -- to see if the value is memoized, and if not we try and fetch it from -- the argument tables. When we check memoization, we need to check -- metaArgs before nilArgs, as both can be non-nil at the same time. -- If the argument is not present in metaArgs, we also check whether -- pairs has been run yet. If pairs has already been run, we return nil. -- This is because all the arguments will have already been copied into -- metaArgs by the mergeArgs function, meaning that any other arguments -- must be nil. --]] if type(key) == 'string' then key = options.translate[key] end local val = metaArgs[key] if val ~= nil then return val elseif metatable.donePairs or nilArgs[key] then return nil end for _, argTable in ipairs(argTables) do local argTableVal = tidyVal(key, argTable[key]) if argTableVal ~= nil then metaArgs[key] = argTableVal return argTableVal end end nilArgs[key] = 'h' return nil end metatable.__newindex = function (t, key, val) -- This function is called when a module tries to add a new value to the -- args table, or tries to change an existing value. if type(key) == 'string' then key = options.translate[key] end if options.readOnly then error( 'could not write to argument table key "' .. tostring(key) .. '"; the table is read-only', 2 ) elseif options.noOverwrite and args[key] ~= nil then error( 'could not write to argument table key "' .. tostring(key) .. '"; overwriting existing arguments is not permitted', 2 ) elseif val == nil then --[[ -- If the argument is to be overwritten with nil, we need to erase -- the value in metaArgs, so that __index, __pairs and __ipairs do -- not use a previous existing value, if present; and we also need -- to memoize the nil in nilArgs, so that the value isn't looked -- up in the argument tables if it is accessed again. --]] metaArgs[key] = nil nilArgs[key] = 'h' else metaArgs[key] = val end end local function translatenext(invariant) local k, v = next(invariant.t, invariant.k) invariant.k = k if k == nil then return nil elseif type(k) ~= 'string' or not options.backtranslate then return k, v else local backtranslate = options.backtranslate[k] if backtranslate == nil then -- Skip this one. This is a tail call, so this won't cause stack overflow return translatenext(invariant) else return backtranslate, v end end end metatable.__pairs = function () -- Called when pairs is run on the args table. if not metatable.donePairs then mergeArgs(argTables) metatable.donePairs = true end return translatenext, { t = metaArgs } end local function inext(t, i) -- This uses our __index metamethod local v = t[i + 1] if v ~= nil then return i + 1, v end end metatable.__ipairs = function (t) -- Called when ipairs is run on the args table. return inext, t, 0 end return args end return arguments 5qx9tzlul9ser30uxj9nbasjt92cevn Module:Message box 828 3303 7203 6525 2022-11-07T04:51:04Z Legoktm 132 Replace [[Module:No globals]] with [[mw:Extension:Scribunto/Lua_reference_manual#Strict_library|require( "strict" )]] 7203 Scribunto text/plain -- This is a meta-module for producing message box templates, including -- {{mbox}}, {{ambox}}, {{imbox}}, {{tmbox}}, {{ombox}}, {{cmbox}} and {{fmbox}}. -- Load necessary modules. require('strict') local getArgs local yesno = require('Module:Yesno') -- Get a language object for formatDate and ucfirst. local lang = mw.language.getContentLanguage() -- Define constants local CONFIG_MODULE = 'Module:Message box/configuration' -------------------------------------------------------------------------------- -- Helper functions -------------------------------------------------------------------------------- local function getTitleObject(...) -- Get the title object, passing the function through pcall -- in case we are over the expensive function count limit. local success, title = pcall(mw.title.new, ...) if success then return title end end local function union(t1, t2) -- Returns the union of two arrays. local vals = {} for i, v in ipairs(t1) do vals[v] = true end for i, v in ipairs(t2) do vals[v] = true end local ret = {} for k in pairs(vals) do table.insert(ret, k) end table.sort(ret) return ret end local function getArgNums(args, prefix) local nums = {} for k, v in pairs(args) do local num = mw.ustring.match(tostring(k), '^' .. prefix .. '([1-9]%d*)$') if num then table.insert(nums, tonumber(num)) end end table.sort(nums) return nums end -------------------------------------------------------------------------------- -- Box class definition -------------------------------------------------------------------------------- local MessageBox = {} MessageBox.__index = MessageBox function MessageBox.new(boxType, args, cfg) args = args or {} local obj = {} -- Set the title object and the namespace. obj.title = getTitleObject(args.page) or mw.title.getCurrentTitle() -- Set the config for our box type. obj.cfg = cfg[boxType] if not obj.cfg then local ns = obj.title.namespace -- boxType is "mbox" or invalid input if ns == 0 then obj.cfg = cfg.ambox -- main namespace elseif ns == 6 then obj.cfg = cfg.imbox -- file namespace elseif ns == 14 then obj.cfg = cfg.cmbox -- category namespace else local nsTable = mw.site.namespaces[ns] if nsTable and nsTable.isTalk then obj.cfg = cfg.tmbox -- any talk namespace else obj.cfg = cfg.ombox -- other namespaces or invalid input end end end -- Set the arguments, and remove all blank arguments except for the ones -- listed in cfg.allowBlankParams. do local newArgs = {} for k, v in pairs(args) do if v ~= '' then newArgs[k] = v end end for i, param in ipairs(obj.cfg.allowBlankParams or {}) do newArgs[param] = args[param] end obj.args = newArgs end -- Define internal data structure. obj.categories = {} obj.classes = {} -- For lazy loading of [[Module:Category handler]]. obj.hasCategories = false return setmetatable(obj, MessageBox) end function MessageBox:addCat(ns, cat, sort) if not cat then return nil end if sort then cat = string.format('[[Category:%s|%s]]', cat, sort) else cat = string.format('[[Category:%s]]', cat) end self.hasCategories = true self.categories[ns] = self.categories[ns] or {} table.insert(self.categories[ns], cat) end function MessageBox:addClass(class) if not class then return nil end table.insert(self.classes, class) end function MessageBox:setParameters() local args = self.args local cfg = self.cfg -- Get type data. self.type = args.type local typeData = cfg.types[self.type] self.invalidTypeError = cfg.showInvalidTypeError and self.type and not typeData typeData = typeData or cfg.types[cfg.default] self.typeClass = typeData.class self.typeImage = typeData.image -- Find if the box has been wrongly substituted. self.isSubstituted = cfg.substCheck and args.subst == 'SUBST' -- Find whether we are using a small message box. self.isSmall = cfg.allowSmall and ( cfg.smallParam and args.small == cfg.smallParam or not cfg.smallParam and yesno(args.small) ) -- Add attributes, classes and styles. self.id = args.id if yesno(args.plainlinks) ~= false then self:addClass('plainlinks') end for _, class in ipairs(cfg.classes or {}) do self:addClass(class) end if self.isSmall then self:addClass(cfg.smallClass or 'mbox-small') end self:addClass(self.typeClass) self:addClass(args.class) self.style = args.style self.attrs = args.attrs -- Set text style. self.textstyle = args.textstyle -- Find if we are on the template page or not. This functionality is only -- used if useCollapsibleTextFields is set, or if both cfg.templateCategory -- and cfg.templateCategoryRequireName are set. self.useCollapsibleTextFields = cfg.useCollapsibleTextFields if self.useCollapsibleTextFields or cfg.templateCategory and cfg.templateCategoryRequireName then self.name = args.name if self.name then local templateName = mw.ustring.match( self.name, '^[tT][eE][mM][pP][lL][aA][tT][eE][%s_]*:[%s_]*(.*)$' ) or self.name templateName = 'Template:' .. templateName self.templateTitle = getTitleObject(templateName) end self.isTemplatePage = self.templateTitle and mw.title.equals(self.title, self.templateTitle) end -- Process data for collapsible text fields. At the moment these are only -- used in {{ambox}}. if self.useCollapsibleTextFields then -- Get the self.issue value. if self.isSmall and args.smalltext then self.issue = args.smalltext else local sect if args.sect == '' then sect = 'This ' .. (cfg.sectionDefault or 'page') elseif type(args.sect) == 'string' then sect = 'This ' .. args.sect end local issue = args.issue issue = type(issue) == 'string' and issue ~= '' and issue or nil local text = args.text text = type(text) == 'string' and text or nil local issues = {} table.insert(issues, sect) table.insert(issues, issue) table.insert(issues, text) self.issue = table.concat(issues, ' ') end -- Get the self.talk value. local talk = args.talk -- Show talk links on the template page or template subpages if the talk -- parameter is blank. if talk == '' and self.templateTitle and ( mw.title.equals(self.templateTitle, self.title) or self.title:isSubpageOf(self.templateTitle) ) then talk = '#' elseif talk == '' then talk = nil end if talk then -- If the talk value is a talk page, make a link to that page. Else -- assume that it's a section heading, and make a link to the talk -- page of the current page with that section heading. local talkTitle = getTitleObject(talk) local talkArgIsTalkPage = true if not talkTitle or not talkTitle.isTalkPage then talkArgIsTalkPage = false talkTitle = getTitleObject( self.title.text, mw.site.namespaces[self.title.namespace].talk.id ) end if talkTitle and talkTitle.exists then local talkText = 'Relevant discussion may be found on' if talkArgIsTalkPage then talkText = string.format( '%s [[%s|%s]].', talkText, talk, talkTitle.prefixedText ) else talkText = string.format( '%s the [[%s#%s|talk page]].', talkText, talkTitle.prefixedText, talk ) end self.talk = talkText end end -- Get other values. self.fix = args.fix ~= '' and args.fix or nil local date if args.date and args.date ~= '' then date = args.date elseif args.date == '' and self.isTemplatePage then date = lang:formatDate('F Y') end if date then self.date = string.format(" <small>''(%s)''</small>", date) end self.info = args.info if yesno(args.removalnotice) then self.removalNotice = cfg.removalNotice end end -- Set the non-collapsible text field. At the moment this is used by all box -- types other than ambox, and also by ambox when small=yes. if self.isSmall then self.text = args.smalltext or args.text else self.text = args.text end -- Set the below row. self.below = cfg.below and args.below -- General image settings. self.imageCellDiv = not self.isSmall and cfg.imageCellDiv self.imageEmptyCell = cfg.imageEmptyCell if cfg.imageEmptyCellStyle then self.imageEmptyCellStyle = 'border:none;padding:0px;width:1px' end -- Left image settings. local imageLeft = self.isSmall and args.smallimage or args.image if cfg.imageCheckBlank and imageLeft ~= 'blank' and imageLeft ~= 'none' or not cfg.imageCheckBlank and imageLeft ~= 'none' then self.imageLeft = imageLeft if not imageLeft then local imageSize = self.isSmall and (cfg.imageSmallSize or '30x30px') or '40x40px' self.imageLeft = string.format('[[File:%s|%s|link=|alt=]]', self.typeImage or 'Imbox notice.png', imageSize) end end -- Right image settings. local imageRight = self.isSmall and args.smallimageright or args.imageright if not (cfg.imageRightNone and imageRight == 'none') then self.imageRight = imageRight end end function MessageBox:setMainspaceCategories() local args = self.args local cfg = self.cfg if not cfg.allowMainspaceCategories then return nil end local nums = {} for _, prefix in ipairs{'cat', 'category', 'all'} do args[prefix .. '1'] = args[prefix] nums = union(nums, getArgNums(args, prefix)) end -- The following is roughly equivalent to the old {{Ambox/category}}. local date = args.date date = type(date) == 'string' and date local preposition = 'from' for _, num in ipairs(nums) do local mainCat = args['cat' .. tostring(num)] or args['category' .. tostring(num)] local allCat = args['all' .. tostring(num)] mainCat = type(mainCat) == 'string' and mainCat allCat = type(allCat) == 'string' and allCat if mainCat and date and date ~= '' then local catTitle = string.format('%s %s %s', mainCat, preposition, date) self:addCat(0, catTitle) catTitle = getTitleObject('Category:' .. catTitle) if not catTitle or not catTitle.exists then self:addCat(0, 'Articles with invalid date parameter in template') end elseif mainCat and (not date or date == '') then self:addCat(0, mainCat) end if allCat then self:addCat(0, allCat) end end end function MessageBox:setTemplateCategories() local args = self.args local cfg = self.cfg -- Add template categories. if cfg.templateCategory then if cfg.templateCategoryRequireName then if self.isTemplatePage then self:addCat(10, cfg.templateCategory) end elseif not self.title.isSubpage then self:addCat(10, cfg.templateCategory) end end -- Add template error categories. if cfg.templateErrorCategory then local templateErrorCategory = cfg.templateErrorCategory local templateCat, templateSort if not self.name and not self.title.isSubpage then templateCat = templateErrorCategory elseif self.isTemplatePage then local paramsToCheck = cfg.templateErrorParamsToCheck or {} local count = 0 for i, param in ipairs(paramsToCheck) do if not args[param] then count = count + 1 end end if count > 0 then templateCat = templateErrorCategory templateSort = tostring(count) end if self.categoryNums and #self.categoryNums > 0 then templateCat = templateErrorCategory templateSort = 'C' end end self:addCat(10, templateCat, templateSort) end end function MessageBox:setAllNamespaceCategories() -- Set categories for all namespaces. if self.invalidTypeError then local allSort = (self.title.namespace == 0 and 'Main:' or '') .. self.title.prefixedText self:addCat('all', 'Wikipedia message box parameter needs fixing', allSort) end if self.isSubstituted then self:addCat('all', 'Pages with incorrectly substituted templates') end end function MessageBox:setCategories() if self.title.namespace == 0 then self:setMainspaceCategories() elseif self.title.namespace == 10 then self:setTemplateCategories() end self:setAllNamespaceCategories() end function MessageBox:renderCategories() if not self.hasCategories then -- No categories added, no need to pass them to Category handler so, -- if it was invoked, it would return the empty string. -- So we shortcut and return the empty string. return "" end -- Convert category tables to strings and pass them through -- [[Module:Category handler]]. return require('Module:Category handler')._main{ main = table.concat(self.categories[0] or {}), template = table.concat(self.categories[10] or {}), all = table.concat(self.categories.all or {}), nocat = self.args.nocat, page = self.args.page } end function MessageBox:export() local root = mw.html.create() -- Add the subst check error. if self.isSubstituted and self.name then root:tag('b') :addClass('error') :wikitext(string.format( 'Template <code>%s[[Template:%s|%s]]%s</code> has been incorrectly substituted.', mw.text.nowiki('{{'), self.name, self.name, mw.text.nowiki('}}') )) end -- Create the box table. local boxTable = root:tag('table') boxTable:attr('id', self.id or nil) for i, class in ipairs(self.classes or {}) do boxTable:addClass(class or nil) end boxTable :cssText(self.style or nil) :attr('role', 'presentation') if self.attrs then boxTable:attr(self.attrs) end -- Add the left-hand image. local row = boxTable:tag('tr') if self.imageLeft then local imageLeftCell = row:tag('td'):addClass('mbox-image') if self.imageCellDiv then -- If we are using a div, redefine imageLeftCell so that the image -- is inside it. Divs use style="width: 52px;", which limits the -- image width to 52px. If any images in a div are wider than that, -- they may overlap with the text or cause other display problems. imageLeftCell = imageLeftCell:tag('div'):css('width', '52px') end imageLeftCell:wikitext(self.imageLeft or nil) elseif self.imageEmptyCell then -- Some message boxes define an empty cell if no image is specified, and -- some don't. The old template code in templates where empty cells are -- specified gives the following hint: "No image. Cell with some width -- or padding necessary for text cell to have 100% width." row:tag('td') :addClass('mbox-empty-cell') :cssText(self.imageEmptyCellStyle or nil) end -- Add the text. local textCell = row:tag('td'):addClass('mbox-text') if self.useCollapsibleTextFields then -- The message box uses advanced text parameters that allow things to be -- collapsible. At the moment, only ambox uses this. textCell:cssText(self.textstyle or nil) local textCellDiv = textCell:tag('div') textCellDiv :addClass('mbox-text-span') :wikitext(self.issue or nil) if (self.talk or self.fix) and not self.isSmall then textCellDiv:tag('span') :addClass('hide-when-compact') :wikitext(self.talk and (' ' .. self.talk) or nil) :wikitext(self.fix and (' ' .. self.fix) or nil) end textCellDiv:wikitext(self.date and (' ' .. self.date) or nil) if self.info and not self.isSmall then textCellDiv :tag('span') :addClass('hide-when-compact') :wikitext(self.info and (' ' .. self.info) or nil) end if self.removalNotice then textCellDiv:tag('small') :addClass('hide-when-compact') :tag('i') :wikitext(string.format(" (%s)", self.removalNotice)) end else -- Default text formatting - anything goes. textCell :cssText(self.textstyle or nil) :wikitext(self.text or nil) end -- Add the right-hand image. if self.imageRight then local imageRightCell = row:tag('td'):addClass('mbox-imageright') if self.imageCellDiv then -- If we are using a div, redefine imageRightCell so that the image -- is inside it. imageRightCell = imageRightCell:tag('div'):css('width', '52px') end imageRightCell :wikitext(self.imageRight or nil) end -- Add the below row. if self.below then boxTable:tag('tr') :tag('td') :attr('colspan', self.imageRight and '3' or '2') :addClass('mbox-text') :cssText(self.textstyle or nil) :wikitext(self.below or nil) end -- Add error message for invalid type parameters. if self.invalidTypeError then root:tag('div') :css('text-align', 'center') :wikitext(string.format( 'This message box is using an invalid "type=%s" parameter and needs fixing.', self.type or '' )) end -- Add categories. root:wikitext(self:renderCategories() or nil) return tostring(root) end -------------------------------------------------------------------------------- -- Exports -------------------------------------------------------------------------------- local p, mt = {}, {} function p._exportClasses() -- For testing. return { MessageBox = MessageBox } end function p.main(boxType, args, cfgTables) local box = MessageBox.new(boxType, args, cfgTables or mw.loadData(CONFIG_MODULE)) box:setParameters() box:setCategories() return box:export() end function mt.__index(t, k) return function (frame) if not getArgs then getArgs = require('Module:Arguments').getArgs end return t.main(k, getArgs(frame, {trim = false, removeBlanks = false})) end end return setmetatable(p, mt) lxqm188f678ppu6ahj8ijb68sm22z2t Module:No globals 828 3304 6526 2020-04-28T07:38:52Z Раммон 1763 Nuwe bladsy geskep met 'local mt = getmetatable(_G) or {} function mt.__index (t, k) if k ~= 'arg' then error('Tried to read nil global ' .. tostring(k), 2) end return nil end function mt._...' 6526 Scribunto text/plain local mt = getmetatable(_G) or {} function mt.__index (t, k) if k ~= 'arg' then error('Tried to read nil global ' .. tostring(k), 2) end return nil end function mt.__newindex(t, k, v) if k ~= 'arg' then error('Tried to write global ' .. tostring(k), 2) end rawset(t, k, v) end setmetatable(_G, mt) gggsv54pq7f94l3up48hr91qtxnskdm Module:Yesno 828 3305 6527 2020-04-28T07:40:32Z Раммон 1763 Nuwe bladsy geskep met '-- Function allowing for consistent treatment of boolean-like wikitext input. -- It works similarly to the template {{yesno}}. return function (val, default) -- If your...' 6527 Scribunto text/plain -- Function allowing for consistent treatment of boolean-like wikitext input. -- It works similarly to the template {{yesno}}. return function (val, default) -- If your wiki uses non-ascii characters for any of "yes", "no", etc., you -- should replace "val:lower()" with "mw.ustring.lower(val)" in the -- following line. val = type(val) == 'string' and val:lower() or val if val == nil then return nil elseif val == true or val == 'yes' or val == 'y' or val == 'true' or val == 't' or tonumber(val) == 1 then return true elseif val == false or val == 'no' or val == 'n' or val == 'false' or val == 'f' or tonumber(val) == 0 then return false else return default end end 266x81qzpz9iq1b5gft4zsdy5qzbnwi Module:Dokumentasie/config 828 3306 6528 2020-04-28T07:42:22Z Раммон 1763 Nuwe bladsy geskep met '---------------------------------------------------------------------------------------------------- -- -- Configuration for Module:Document...' 6528 Scribunto text/plain ---------------------------------------------------------------------------------------------------- -- -- Configuration for Module:Documentation -- -- Here you can set the values of the parameters and messages used in Module:Documentation to -- localise it to your wiki and your language. Unless specified otherwise, values given here -- should be string values. ---------------------------------------------------------------------------------------------------- local cfg = {} -- Do not edit this line. ---------------------------------------------------------------------------------------------------- -- Protection template configuration ---------------------------------------------------------------------------------------------------- -- cfg['protection-reason-edit'] -- The protection reason for edit-protected templates to pass to -- [[Module:Protection banner]]. cfg['protection-reason-edit'] = 'sjabloon' --[[ ---------------------------------------------------------------------------------------------------- -- Sandbox notice configuration -- -- On sandbox pages the module can display a template notifying users that the current page is a -- sandbox, and the location of test cases pages, etc. The module decides whether the page is a -- sandbox or not based on the value of cfg['sandbox-subpage']. The following settings configure the -- messages that the notices contains. ---------------------------------------------------------------------------------------------------- --]] -- cfg['sandbox-notice-image'] -- The image displayed in the sandbox notice. cfg['sandbox-notice-image'] = '[[Lêer:Sandbox.svg|50px|alt=|link=]]' --[[ -- cfg['sandbox-notice-pagetype-template'] -- cfg['sandbox-notice-pagetype-module'] -- cfg['sandbox-notice-pagetype-other'] -- The page type of the sandbox page. The message that is displayed depends on the current subject -- namespace. This message is used in either cfg['sandbox-notice-blurb'] or -- cfg['sandbox-notice-diff-blurb']. --]] cfg['sandbox-notice-pagetype-template'] = '[[Wikipedia:Sjabloonsandput en -toetsgevalle|Sjabloonsandput]]blad' cfg['sandbox-notice-pagetype-module'] = '[[Wikipedia:Sjabloonsandput en -toetsgevalle|modulesandput]]blad' cfg['sandbox-notice-pagetype-other'] = 'sandputblad' --[[ -- cfg['sandbox-notice-blurb'] -- cfg['sandbox-notice-diff-blurb'] -- cfg['sandbox-notice-diff-display'] -- Either cfg['sandbox-notice-blurb'] or cfg['sandbox-notice-diff-blurb'] is the opening sentence -- of the sandbox notice. The latter has a diff link, but the former does not. $1 is the page -- type, which is either cfg['sandbox-notice-pagetype-template'], -- cfg['sandbox-notice-pagetype-module'] or cfg['sandbox-notice-pagetype-other'] depending what -- namespace we are in. $2 is a link to the main template page, and $3 is a diff link between -- the sandbox and the main template. The display value of the diff link is set by -- cfg['sandbox-notice-compare-link-display']. --]] cfg['sandbox-notice-blurb'] = 'Dit is die $1 vir $2.' cfg['sandbox-notice-diff-blurb'] = 'Dit is die $1 vir $2 ($3).' cfg['sandbox-notice-compare-link-display'] = 'verskil' --[[ -- cfg['sandbox-notice-testcases-blurb'] -- cfg['sandbox-notice-testcases-link-display'] -- cfg['sandbox-notice-testcases-run-blurb'] -- cfg['sandbox-notice-testcases-run-link-display'] -- cfg['sandbox-notice-testcases-blurb'] is a sentence notifying the user that there is a test cases page -- corresponding to this sandbox that they can edit. $1 is a link to the test cases page. -- cfg['sandbox-notice-testcases-link-display'] is the display value for that link. -- cfg['sandbox-notice-testcases-run-blurb'] is a sentence notifying the user that there is a test cases page -- corresponding to this sandbox that they can edit, along with a link to run it. $1 is a link to the test -- cases page, and $2 is a link to the page to run it. -- cfg['sandbox-notice-testcases-run-link-display'] is the display value for the link to run the test -- cases. --]] cfg['sandbox-notice-testcases-blurb'] = 'Sien ook die meegaande subbladsy vir $1.' cfg['sandbox-notice-testcases-link-display'] = 'toetsgevalle' cfg['sandbox-notice-testcases-run-blurb'] = 'Sien ook die meegaande subbladsy vir $1 ($2).' cfg['sandbox-notice-testcases-run-link-display'] = 'loop' -- cfg['sandbox-category'] -- A category to add to all template sandboxes. cfg['sandbox-category'] = 'Sjabloonsandputte' ---------------------------------------------------------------------------------------------------- -- Start box configuration ---------------------------------------------------------------------------------------------------- -- cfg['documentation-icon-wikitext'] -- The wikitext for the icon shown at the top of the template. cfg['documentation-icon-wikitext'] = '[[Lêer:Test Template Info-Icon - Version (2).svg|50px|link=|alt=Dokumentasie-ikoon]]' -- cfg['template-namespace-heading'] -- The heading shown in the template namespace. cfg['template-namespace-heading'] = 'Sjabloondokumentasie' -- cfg['module-namespace-heading'] -- The heading shown in the module namespace. cfg['module-namespace-heading'] = 'Moduledokumentasie' -- cfg['file-namespace-heading'] -- The heading shown in the file namespace. cfg['file-namespace-heading'] = 'Samevatting' -- cfg['other-namespaces-heading'] -- The heading shown in other namespaces. cfg['other-namespaces-heading'] = 'Dokumentasie' -- cfg['view-link-display'] -- The text to display for "view" links. cfg['view-link-display'] = 'sien' -- cfg['edit-link-display'] -- The text to display for "edit" links. cfg['edit-link-display'] = 'wysig' -- cfg['history-link-display'] -- The text to display for "history" links. cfg['history-link-display'] = 'geskiedenis' -- cfg['purge-link-display'] -- The text to display for "purge" links. cfg['purge-link-display'] = 'wis kasgeheue' -- cfg['create-link-display'] -- The text to display for "create" links. cfg['create-link-display'] = 'skep' ---------------------------------------------------------------------------------------------------- -- Link box (end box) configuration ---------------------------------------------------------------------------------------------------- -- cfg['transcluded-from-blurb'] -- Notice displayed when the docs are transcluded from another page. $1 is a wikilink to that page. cfg['transcluded-from-blurb'] = 'Die bostaande [[Wikipedia:Sjabloondokumentasie|dokumentasie]] is [[Wikipedia:Transklusie|ingesluit]] vanaf $1.' --[[ -- cfg['create-module-doc-blurb'] -- Notice displayed in the module namespace when the documentation subpage does not exist. -- $1 is a link to create the documentation page with the preload cfg['module-preload'] and the -- display cfg['create-link-display']. --]] cfg['create-module-doc-blurb'] = 'Jy wil dalk \'n dokumentblad $1 vir hierdie [[Wikipedia:Lua|Scribunto-module]].' ---------------------------------------------------------------------------------------------------- -- Experiment blurb configuration ---------------------------------------------------------------------------------------------------- --[[ -- cfg['experiment-blurb-template'] -- cfg['experiment-blurb-module'] -- The experiment blurb is the text inviting editors to experiment in sandbox and test cases pages. -- It is only shown in the template and module namespaces. With the default English settings, it -- might look like this: -- -- Editors can experiment in this template's sandbox (edit | diff) and testcases (edit) pages. -- -- In this example, "sandbox", "edit", "diff", "testcases", and "edit" would all be links. -- -- There are two versions, cfg['experiment-blurb-template'] and cfg['experiment-blurb-module'], depending -- on what namespace we are in. -- -- Parameters: -- -- $1 is a link to the sandbox page. If the sandbox exists, it is in the following format: -- -- cfg['sandbox-link-display'] (cfg['sandbox-edit-link-display'] | cfg['compare-link-display']) -- -- If the sandbox doesn't exist, it is in the format: -- -- cfg['sandbox-link-display'] (cfg['sandbox-create-link-display'] | cfg['mirror-link-display']) -- -- The link for cfg['sandbox-create-link-display'] link preloads the page with cfg['template-sandbox-preload'] -- or cfg['module-sandbox-preload'], depending on the current namespace. The link for cfg['mirror-link-display'] -- loads a default edit summary of cfg['mirror-edit-summary']. -- -- $2 is a link to the test cases page. If the test cases page exists, it is in the following format: -- -- cfg['testcases-link-display'] (cfg['testcases-edit-link-display'] | cfg['testcases-run-link-display']) -- -- If the test cases page doesn't exist, it is in the format: -- -- cfg['testcases-link-display'] (cfg['testcases-create-link-display']) -- -- If the test cases page doesn't exist, the link for cfg['testcases-create-link-display'] preloads the -- page with cfg['template-testcases-preload'] or cfg['module-testcases-preload'], depending on the current -- namespace. --]] cfg['experiment-blurb-template'] = "Redigeerders kan eksperimenteer in hierdie sjabloon se $1 en $2 blaaie." cfg['experiment-blurb-module'] = "Redigeerders kan eksperimenteer in hierdie module se $1 en $2 blaaie." ---------------------------------------------------------------------------------------------------- -- Sandbox link configuration ---------------------------------------------------------------------------------------------------- -- cfg['sandbox-subpage'] -- The name of the template subpage typically used for sandboxes. cfg['sandbox-subpage'] = 'sandput' -- cfg['template-sandbox-preload'] -- Preload file for template sandbox pages. cfg['template-sandbox-preload'] = 'Sjabloon:Dokumentasie/vooraflaaisandput' -- cfg['module-sandbox-preload'] -- Preload file for Lua module sandbox pages. cfg['module-sandbox-preload'] = 'Sjabloon:Dokumentasie/vooraflaaimodulesandput' -- cfg['sandbox-link-display'] -- The text to display for "sandbox" links. cfg['sandbox-link-display'] = 'sandput' -- cfg['sandbox-edit-link-display'] -- The text to display for sandbox "edit" links. cfg['sandbox-edit-link-display'] = 'wysig' -- cfg['sandbox-create-link-display'] -- The text to display for sandbox "create" links. cfg['sandbox-create-link-display'] = 'skep' -- cfg['compare-link-display'] -- The text to display for "compare" links. cfg['compare-link-display'] = 'verskil' -- cfg['mirror-edit-summary'] -- The default edit summary to use when a user clicks the "mirror" link. $1 is a wikilink to the -- template page. cfg['mirror-edit-summary'] = 'Skep \'n sandputweergawe van $1' -- cfg['mirror-link-display'] -- The text to display for "mirror" links. cfg['mirror-link-display'] = 'spieël' -- cfg['mirror-link-preload'] -- The page to preload when a user clicks the "mirror" link. cfg['mirror-link-preload'] = 'Sjabloon:Dokumentasie/spieël' ---------------------------------------------------------------------------------------------------- -- Test cases link configuration ---------------------------------------------------------------------------------------------------- -- cfg['testcases-subpage'] -- The name of the template subpage typically used for test cases. cfg['testcases-subpage'] = 'toetsgevalle' -- cfg['template-testcases-preload'] -- Preload file for template test cases pages. cfg['template-testcases-preload'] = 'Sjabloon:Documentasie/vooraflaaitoetsgevalle' -- cfg['module-testcases-preload'] -- Preload file for Lua module test cases pages. cfg['module-testcases-preload'] = 'Sjabloon:Dokumentasie/vooraflaaimoduletoetsgevalle' -- cfg['testcases-link-display'] -- The text to display for "testcases" links. cfg['testcases-link-display'] = 'toetsgevalle' -- cfg['testcases-edit-link-display'] -- The text to display for test cases "edit" links. cfg['testcases-edit-link-display'] = 'wysig' -- cfg['testcases-run-link-display'] -- The text to display for test cases "run" links. cfg['testcases-run-link-display'] = 'loop' -- cfg['testcases-create-link-display'] -- The text to display for test cases "create" links. cfg['testcases-create-link-display'] = 'skep' ---------------------------------------------------------------------------------------------------- -- Add categories blurb configuration ---------------------------------------------------------------------------------------------------- --[[ -- cfg['add-categories-blurb'] -- Text to direct users to add categories to the /doc subpage. Not used if the "content" or -- "docname fed" arguments are set, as then it is not clear where to add the categories. $1 is a -- link to the /doc subpage with a display value of cfg['doc-link-display']. --]] cfg['add-categories-blurb'] = 'Plaas asseblief kategorieë op die $1-subbladsy.' -- cfg['doc-link-display'] -- The text to display when linking to the /doc subpage. cfg['doc-link-display'] = '/doc' ---------------------------------------------------------------------------------------------------- -- Subpages link configuration ---------------------------------------------------------------------------------------------------- --[[ -- cfg['subpages-blurb'] -- The "Subpages of this template" blurb. $1 is a link to the main template's subpages with a -- display value of cfg['subpages-link-display']. In the English version this blurb is simply -- the link followed by a period, and the link display provides the actual text. --]] cfg['subpages-blurb'] = '$1.' --[[ -- cfg['subpages-link-display'] -- The text to display for the "subpages of this page" link. $1 is cfg['template-pagetype'], -- cfg['module-pagetype'] or cfg['default-pagetype'], depending on whether the current page is in -- the template namespace, the module namespace, or another namespace. --]] cfg['subpages-link-display'] = 'Subbladsye vir die $1' -- cfg['template-pagetype'] -- The pagetype to display for template pages. cfg['template-pagetype'] = 'sjabloon' -- cfg['module-pagetype'] -- The pagetype to display for Lua module pages. cfg['module-pagetype'] = 'module' -- cfg['default-pagetype'] -- The pagetype to display for pages other than templates or Lua modules. cfg['default-pagetype'] = 'blad' ---------------------------------------------------------------------------------------------------- -- Doc link configuration ---------------------------------------------------------------------------------------------------- -- cfg['doc-subpage'] -- The name of the subpage typically used for documentation pages. cfg['doc-subpage'] = 'doc' -- cfg['file-docpage-preload'] -- Preload file for documentation page in the file namespace. cfg['file-docpage-preload'] = 'Sjabloon:Dokumentasie/vooraflaailêernaamruimte' -- cfg['docpage-preload'] -- Preload file for template documentation pages in all namespaces. cfg['docpage-preload'] = 'Sjabloon:Dokumentasie/vooraflaai' -- cfg['module-preload'] -- Preload file for Lua module documentation pages. cfg['module-preload'] = 'Sjabloon:Dokumentasie/vooraflaaimoduledoc' ---------------------------------------------------------------------------------------------------- -- Print version configuration ---------------------------------------------------------------------------------------------------- -- cfg['print-subpage'] -- The name of the template subpage used for print versions. cfg['print-subpage'] = 'Druk' -- cfg['print-link-display'] -- The text to display when linking to the /Print subpage. cfg['print-link-display'] = '/Druk' -- cfg['print-blurb'] -- Text to display if a /Print subpage exists. $1 is a link to the subpage with a display value of cfg['print-link-display']. cfg['print-blurb'] = '\'n [[Help:Books/for experts#Improving the book layout|drukweergawe]] van hierdie sjabloon bestaan by $1.' .. ' Indien jy \'n verandering aan hierdie sjabloon maak, werk asseblief die drukweergawe ook by.' -- cfg['display-print-category'] -- Set to true to enable output of cfg['print-category'] if a /Print subpage exists. -- This should be a boolean value (either true or false). cfg['display-print-category'] = true -- cfg['print-category'] -- Category to output if cfg['display-print-category'] is set to true, and a /Print subpage exists. cfg['print-category'] = 'Sjablone met drukweergawes' ---------------------------------------------------------------------------------------------------- -- HTML and CSS configuration ---------------------------------------------------------------------------------------------------- -- cfg['main-div-id'] -- The "id" attribute of the main HTML "div" tag. cfg['main-div-id'] = 'template-documentation' -- cfg['main-div-classes'] -- The CSS classes added to the main HTML "div" tag. cfg['main-div-classes'] = 'template-documentation iezoomfix' -- cfg['start-box-linkclasses'] -- The CSS classes used for the [view][edit][history] or [create] links in the start box. cfg['start-box-linkclasses'] = 'mw-editsection-like plainlinks' -- cfg['start-box-link-id'] -- The HTML "id" attribute for the links in the start box. cfg['start-box-link-id'] = 'doc_editlinks' ---------------------------------------------------------------------------------------------------- -- {{fmbox}} template configuration ---------------------------------------------------------------------------------------------------- -- cfg['fmbox-id'] -- The id sent to the "id" parameter of the {{fmbox}} template. cfg['fmbox-id'] = 'documentation-meta-data' -- cfg['fmbox-style'] -- The value sent to the style parameter of {{fmbox}}. cfg['fmbox-style'] = 'background-color: #ecfcf4; clear: both; margin: 0.2em 0; width: 100%; border: 1px solid #aaa;' -- cfg['fmbox-textstyle'] -- The value sent to the "textstyle parameter of {{fmbox}}. cfg['fmbox-textstyle'] = 'font-style: italic' ---------------------------------------------------------------------------------------------------- -- Tracking category configuration ---------------------------------------------------------------------------------------------------- -- cfg['display-strange-usage-category'] -- Set to true to enable output of cfg['strange-usage-category'] if the module is used on a /doc subpage -- or a /testcases subpage. This should be a boolean value (either true or false). cfg['display-strange-usage-category'] = true -- cfg['strange-usage-category'] -- Category to output if cfg['display-strange-usage-category'] is set to true and the module is used on a -- /doc subpage or a /testcases subpage. cfg['strange-usage-category'] = 'Wikipedia-blaaie met ongewone ((dokumentasie))gebruik' --[[ ---------------------------------------------------------------------------------------------------- -- End configuration -- -- Don't edit anything below this line. ---------------------------------------------------------------------------------------------------- --]] return cfg alvpz68ehlz0t3uqofzheu75qyaax5v Module:Message box/configuration 828 3307 6529 2020-04-28T07:44:58Z Раммон 1763 Nuwe bladsy geskep met '-------------------------------------------------------------------------------- -- Message box configuration -- --...' 6529 Scribunto text/plain -------------------------------------------------------------------------------- -- Message box configuration -- -- -- -- This module contains configuration data for [[Module:Message box]]. -- -------------------------------------------------------------------------------- return { ambox = { types = { speedy = { class = 'ambox-speedy', image = 'Ambox warning pn.svg' }, delete = { class = 'ambox-delete', image = 'Ambox warning pn.svg' }, content = { class = 'ambox-content', image = 'Ambox important.svg' }, style = { class = 'ambox-style', image = 'Edit-clear.svg' }, move = { class = 'ambox-move', image = 'Merge-split-transwiki default.svg' }, protection = { class = 'ambox-protection', image = 'Padlock-silver-medium.svg' }, notice = { class = 'ambox-notice', image = 'Information icon4.svg' } }, default = 'notice', allowBlankParams = {'talk', 'sect', 'date', 'issue', 'fix', 'subst', 'hidden'}, allowSmall = true, smallParam = 'left', smallClass = 'mbox-small-left', substCheck = true, classes = {'metadata', 'ambox'}, imageEmptyCell = true, imageCheckBlank = true, imageSmallSize = '20x20px', imageCellDiv = true, useCollapsibleTextFields = true, imageRightNone = true, sectionDefault = 'article', allowMainspaceCategories = true, templateCategory = 'Article message templates', templateCategoryRequireName = true, templateErrorCategory = 'Article message templates with missing parameters', templateErrorParamsToCheck = {'issue', 'fix', 'subst'}, removalNotice = '[[Hulp:Verwydering van instandhoudingsjablone|Vind uit wanneer en hoe om hierdie sjabloonboodskap te verwyder]]' }, cmbox = { types = { speedy = { class = 'cmbox-speedy', image = 'Ambox warning pn.svg' }, delete = { class = 'cmbox-delete', image = 'Ambox warning pn.svg' }, content = { class = 'cmbox-content', image = 'Ambox important.svg' }, style = { class = 'cmbox-style', image = 'Edit-clear.svg' }, move = { class = 'cmbox-move', image = 'Merge-split-transwiki default.svg' }, protection = { class = 'cmbox-protection', image = 'Padlock-silver-medium.svg' }, notice = { class = 'cmbox-notice', image = 'Information icon4.svg' } }, default = 'notice', showInvalidTypeError = true, classes = {'cmbox'}, imageEmptyCell = true }, fmbox = { types = { warning = { class = 'fmbox-warning', image = 'Ambox warning pn.svg' }, editnotice = { class = 'fmbox-editnotice', image = 'Information icon4.svg' }, system = { class = 'fmbox-system', image = 'Information icon4.svg' } }, default = 'system', showInvalidTypeError = true, classes = {'fmbox'}, imageEmptyCell = false, imageRightNone = false }, imbox = { types = { speedy = { class = 'imbox-speedy', image = 'Ambox warning pn.svg' }, delete = { class = 'imbox-delete', image = 'Ambox warning pn.svg' }, content = { class = 'imbox-content', image = 'Ambox important.svg' }, style = { class = 'imbox-style', image = 'Edit-clear.svg' }, move = { class = 'imbox-move', image = 'Merge-split-transwiki default.svg' }, protection = { class = 'imbox-protection', image = 'Padlock-silver-medium.svg' }, license = { class = 'imbox-license licensetpl', image = 'Imbox license.png' -- @todo We need an SVG version of this }, featured = { class = 'imbox-featured', image = 'Cscr-featured.svg' }, notice = { class = 'imbox-notice', image = 'Information icon4.svg' } }, default = 'notice', showInvalidTypeError = true, classes = {'imbox'}, imageEmptyCell = true, below = true, templateCategory = 'File message boxes' }, ombox = { types = { speedy = { class = 'ombox-speedy', image = 'Ambox warning pn.svg' }, delete = { class = 'ombox-delete', image = 'Ambox warning pn.svg' }, content = { class = 'ombox-content', image = 'Ambox important.svg' }, style = { class = 'ombox-style', image = 'Edit-clear.svg' }, move = { class = 'ombox-move', image = 'Merge-split-transwiki default.svg' }, protection = { class = 'ombox-protection', image = 'Padlock-silver-medium.svg' }, notice = { class = 'ombox-notice', image = 'Information icon4.svg' } }, default = 'notice', showInvalidTypeError = true, classes = {'ombox'}, allowSmall = true, imageEmptyCell = true, imageRightNone = true }, tmbox = { types = { speedy = { class = 'tmbox-speedy', image = 'Ambox warning pn.svg' }, delete = { class = 'tmbox-delete', image = 'Ambox warning pn.svg' }, content = { class = 'tmbox-content', image = 'Ambox important.svg' }, style = { class = 'tmbox-style', image = 'Edit-clear.svg' }, move = { class = 'tmbox-move', image = 'Merge-split-transwiki default.svg' }, protection = { class = 'tmbox-protection', image = 'Padlock-silver-medium.svg' }, notice = { class = 'tmbox-notice', image = 'Information icon4.svg' } }, default = 'notice', showInvalidTypeError = true, classes = {'tmbox'}, allowSmall = true, imageRightNone = true, imageEmptyCell = true, imageEmptyCellStyle = true, templateCategory = 'Talk message boxes' } } qbqlpsz82sdn0fs66m68wi21jq7jcba Sjabloon:Doc 10 3308 6531 2020-04-28T08:18:15Z Раммон 1763 Раммон het bladsy [[Sjabloon:Doc]] na [[Sjabloon:Dokumentasie]] geskuif 6531 wikitext text/x-wiki #AANSTUUR [[Sjabloon:Dokumentasie]] r3eyoc4npqiu5lwp43m7bl5u73bxxyj Sjabloon:Documentation 10 3309 6532 2020-04-28T10:52:12Z Раммон 1763 Stuur aan na [[Sjabloon:Dokumentasie]] 6532 wikitext text/x-wiki #AANSTUUR [[Sjabloon:Dokumentasie]] r3eyoc4npqiu5lwp43m7bl5u73bxxyj Sjabloon:Tl 10 3310 6533 2020-04-28T10:52:58Z Раммон 1763 Nuwe bladsy geskep met '{{[[Sjabloon:{{{1}}}|{{{1}}}]]}}<noinclude>{{Documentation}}</noinclude>' 6533 wikitext text/x-wiki {{[[Sjabloon:{{{1}}}|{{{1}}}]]}}<noinclude>{{Documentation}}</noinclude> ptvrwsncx8l6oj9ge0odqjrcqud8i6g Gebruikerbespreking:Omar Ghrida 3 3344 6685 2020-06-15T21:48:44Z Turkmen 2075 Turkmen het bladsy [[Gebruikerbespreking:Omar Ghrida]] na [[Gebruikerbespreking:Omar2040]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Omar Ghrida|Omar Ghrida]]" to "[[Special:CentralAuth/Omar2040|Omar2040]]" 6685 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Omar2040]] rin29wcpvz5lo9pfwv6zyei59bv9ewv Gebruikerbespreking:S.Örvarr.S 3 3345 6687 2020-06-21T16:58:44Z DutchTina 2131 DutchTina het bladsy [[Gebruikerbespreking:S.Örvarr.S]] na [[Gebruikerbespreking:Stefán Örvar Sigmundsson]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/S.Örvarr.S|S.Örvarr.S]]" to "[[Special:CentralAuth/Stefán Örvar Sigmundsson|Stefán Örvar Sigmundsson]]" 6687 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Stefán Örvar Sigmundsson]] erm74al8pnmdz38pnuy0ymkf8lfbifm Gebruiker:DeltaQuad 2 3346 6690 2020-06-26T10:19:15Z Sakretsu 2179 Sakretsu het bladsy [[Gebruiker:DeltaQuad]] na [[Gebruiker:AmandaNP]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/DeltaQuad|DeltaQuad]]" to "[[Special:CentralAuth/AmandaNP|AmandaNP]]" 6690 wikitext text/x-wiki #AANSTUUR [[Gebruiker:AmandaNP]] o60f2v6rd5gooebgydgiusff2kmqs0j Gebruikerbespreking:DeltaQuad 3 3347 7388 6691 2024-05-24T00:12:39Z Vít Karásek 2642 double redirect 7388 wikitext text/x-wiki #AANSTUUR [[m:User talk:DeltaQuad]] 6irq98n5i4poi792s5jzf74g07344e2 Gebruiker:Masumrezarock100/minerva.js 2 3366 6762 2020-07-11T04:16:52Z 1997kB 1873 1997kB het bladsy [[Gebruiker:Masumrezarock100/minerva.js]] na [[Gebruiker:Ainz Ooal Gown/minerva.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Masumrezarock100|Masumrezarock100]]" to "[[Special:CentralAuth/Ainz Ooal Gown|Ainz Ooal Gown]]" 6762 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:Ainz_Ooal_Gown/minerva.js\u0026action=raw\u0026ctype=text/javascript"); 5h0uu5f6ssva9pz31wkvkut77zepn9m Gebruikerbespreking:Srdjan m 3 3367 6764 2020-07-15T00:18:19Z 蟲蟲飛 2193 蟲蟲飛 het bladsy [[Gebruikerbespreking:Srdjan m]] na [[Gebruikerbespreking:Srđan]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Srdjan m|Srdjan m]]" to "[[Special:CentralAuth/Srđan|Srđan]]" 6764 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Srđan]] n1cu2k2s1dckse1w36e2iez7ojp5t8f Gebruiker:Erokhin 2 3371 6778 2020-11-28T11:04:20Z Erokhin 2225 Nuwe bladsy geskep met '{{#babel:ru|en-3|la-2}}' 6778 wikitext text/x-wiki {{#babel:ru|en-3|la-2}} b6ib6fkatj0zqbarnhcr366lp6izwgu Gebruiker:Pratyya Ghosh/WSign.js 2 3373 6780 2021-01-05T04:22:38Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Pratyya Ghosh]]) 6780 javascript text/javascript <span style="font-family:Cambria">'''[[User:Pratyya Ghosh|<span style="color:#082567">PratyyaG</span>]] · [[User talk:Pratyya Ghosh|<span style="color:#224C98">Talk</span>]]''' </span> dfkuzrfxb3fokiyj65jf5r4fqfl3qbp Gebruikerbespreking:Septian Hadi 3 3375 7204 6829 2022-11-21T01:01:55Z EmausBot 1982 Robot: dubbele aanstuur na [[Gebruikerbespreking:Sevht]] reggemaak 7204 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Sevht]] 78i48b0r9qmzz4i0rrf3s1gvn8kgy1z Gebruikerbespreking:RacoonyRE 3 3376 6830 2021-03-07T16:47:07Z RacoonyRE 361 Nuwe bladsy geskep met '{| cellpadding="10" cellspacing="5" style="width: 95%; background-color: inherit; margin-left: auto; margin-right: auto" | style="background-color: #FDFDFD; border: 1px s...' 6830 wikitext text/x-wiki {| cellpadding="10" cellspacing="5" style="width: 95%; background-color: inherit; margin-left: auto; margin-right: auto" | style="background-color: #FDFDFD; border: 1px solid #777777; -moz-border-radius-topleft: 8px; -moz-border-radius-bottomleft: 8px; -moz-border-radius-topright: 8px; -moz-border-radius-bottomright: 8px;" colspan="2" | <div style="margin:1.5em; border:3px solid SteelBlue; padding: 1em 1em 1em 1em; background-color:#B0E0E6; align:center;"> <div style="text-align: center; color:red"><big>'''This discussion page is not actively monitored. You can write to me best on [http://meta.wikipedia.org/w/index.php?title=User_talk:RacoonyRE Meta] or in the [https://de.wikipedia.org/w/index.php?title=Benutzer_Diskussion:RacoonyRE German Wikipedia].'''</big></div> '''Dear visitors, I attach importance to a [[de:Wikipedia:Wikiquette|friendly tone]] (Wikiquette). ''' * You can create a new post [http://meta.wikipedia.org/w/index.php?title=User_talk:RacoonyRE&action=edit&section=new here]. '''Please''' always sign with <nowiki>-- ~~~~</nowiki> (two hyphens, four tildes) or by clicking on the icon shown below ''' <span style="text-align: center; background: #F8F9FA; padding: .4em; border:1px solid #BBBBBB; border-radius:5px;">&nbsp;[[File:OOjs UI icon signature-ltr.svg|24px|{{int:wikieditor-toolbar-tool-signature}}|verweis=]]</span> * If you do not want others to read your message, you can also write me an '''[[Special:EmailUser/RacoonyRE|Email]]'''. *'''I basically reply where the discussion started so that it doesn't get torn apart.''' <br />The best thing to do is to watch my discussion page. '''[http://meta.wikipedia.org/w/index.php?title=User_talk:RacoonyRE&action=watch (Click here)]''' </div> ka724xzol91ets442bv1tzsilddbeef Gebruikerbespreking:InternetArchiveBot 3 3377 6837 6833 2021-06-16T00:37:19Z 24.21.78.216 Changed redirect target from [[en:User talk:InternetArchiveBot]] to [[meta:User talk:InternetArchiveBot]] 6837 wikitext text/x-wiki #REDIRECT[[meta:User talk:InternetArchiveBot]] ihe6s1lbzqd8gasxnoewu85gshqim7x Gebruiker:ZI Jony/minerva.js 2 3378 6834 2021-05-01T16:35:24Z Pathoschild 29 global user pages ([[m:Synchbot|requested by ZI Jony]]) 6834 javascript text/javascript mw.loader.load('//meta.wikimedia.org/w/index.php?title=User:ZI_Jony/mobile-global.js&action=raw&ctype=text/javascript'); 1ud4suvkeq8qtlm36a2g10cfg17vxfa Gebruikerbespreking:Nricardo 3 3379 6836 2021-05-17T14:58:51Z Deepfriedokra 2219 Deepfriedokra het bladsy [[Gebruikerbespreking:Nricardo]] na [[Gebruikerbespreking:Nelson Ricardo 2500]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Nricardo|Nricardo]]" to "[[Special:CentralAuth/Nelson Ricardo 2500|Nelson Ricardo 2500]]" 6836 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Nelson Ricardo 2500]] 2ny2amr8i75y8917dhve1hkdtdukhoz Gebruiker:Killarnee 2 3380 6839 2021-06-27T14:11:23Z Killarnee 2124 Nuwe bladsy geskep met '<div style="width:800px;margin:0 auto;box-shadow:0 4px 8px 0 rgba(0, 0, 0, 0.5), 0 6px 20px 0 rgba(0, 0, 0, 0.5);position:relative;color:rgba(255,255,255,0.75);background...' 6839 wikitext text/x-wiki <div style="width:800px;margin:0 auto;box-shadow:0 4px 8px 0 rgba(0, 0, 0, 0.5), 0 6px 20px 0 rgba(0, 0, 0, 0.5);position:relative;color:rgba(255,255,255,0.75);background-color:transparent;margin:0 auto;">[[File:hello generic user.png|800px|link=]]<div style="position:absolute;left:3em;bottom:3em;width:250px;border:none;background-color:none;">[[w:User:Killarnee|<span style="color:rgba(255,255,255,0.75);font-size:2em">On Wikipedia ➔</span>]]</div></div> q2pzqtnz1cb19pkup39yrjr4igfvk4v Gebruikerbespreking:MNadzikiewicz (WMF) 3 3382 7192 7179 2022-07-18T01:39:34Z MediaWiki message delivery 1367 /* Movement Strategy and Governance News – Issue 7 */ nuwe afdeling 7192 wikitext text/x-wiki == Universal Code of Conduct News – Issue 2 == <section begin="ucoc-newsletter"/> <div style = "line-height: 1.2"> <span style="font-size:200%;">'''Universal Code of Conduct News'''</span><br> <span style="font-size:120%; color:#404040;">'''Issue 2, July 2021'''</span><span style="font-size:120%; float:right;">[[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2|'''Read the full newsletter''']]</span> ---- Welcome to the second issue of [[m:Special:MyLanguage/Universal Code of Conduct|Universal Code of Conduct]] News! This newsletter will help Wikimedians stay involved with the development of the new code and will distribute relevant news, research, and upcoming events related to the UCoC. If you haven’t already, please remember to subscribe [[m:Special:MyLanguage/Global message delivery/Targets/UCoC Newsletter Subscription|here]] if you would like to be notified about future editions of the newsletter, and also leave your username [[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/Participate|here]] if you’d like to be contacted to help with translations in the future. </div><div style="margin-top:3px; padding:10px 10px 10px 20px; background:#fffff; border:2px solid #808080; border-radius:4px; font-size:100%;"> *'''Enforcement Draft Guidelines Review''' - Initial meetings of the drafting committee have helped to connect and align key topics on enforcement, while highlighting prior research around existing processes and gaps within our movement. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Enforcement Draft Guidelines Review|continue reading]]) *'''Targets of Harassment Research''' - To support the drafting committee, the Wikimedia Foundation has conducted a research project focused on experiences of harassment on Wikimedia projects. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Targets of Harassment Research|continue reading]]) *'''Functionaries’ Consultation''' - Since June, Functionaries from across the various wikis have been meeting to discuss what the future will look like in a global context with the UCoC. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Functionaries’ Consultation|continue reading]]) *'''Roundtable Discussions''' - The UCoC facilitation team once again, hosted another roundtable discussion, this time for Korean-speaking community members and participants of other ESEAP projects to discuss the enforcement of the UCoC. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Roundtable Discussions|continue reading]]) *'''Early Adoption of UCoC by Communities''' - Since its ratification by the Board in February 2021, situations whereby UCoC is being adopted and applied within the Wikimedia community have grown. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Early Adoption of UCoC by Communities|continue reading]]) *'''New Timeline for the Interim Trust & Safety Case Review Committee''' - The CRC was originally expected to conclude by July 1. However, with the UCoC now expected to be in development until December, the timeline for the CRC has also changed. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#New Timeline for the Interim Trust & Safety Case Review Committee|continue reading]]) *'''Wikimania''' - The UCoC team is planning to hold a moderated discussion featuring representatives across the movement during Wikimania 2021. It also plans to have a presence at the conference’s Community Village. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Wikimania Session|continue reading]]) *'''Diff blogs''' - Check out the most recent publications about the UCoC on Wikimedia Diff blog. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/2#Diff Blogs|continue reading]]) </div><section end="ucoc-newsletter"/> :Thanks for reading - we welcome feedback about this newsletter. [[Gebruiker:Xeno (WMF)|Xeno (WMF)]] ([[Gebruikerbespreking:Xeno (WMF)|kontak]]) 23:03, 15 Julie 2021 (UTC) == Universal Code of Conduct News – Issue 3 == <section begin="ucoc-newsletter"/> <div style = "line-height: 1.2"> <span style="font-size:200%;">'''Universal Code of Conduct News'''</span><br> <span style="font-size:120%; color:#404040;">'''Issue 3, August 2021'''</span><span style="font-size:120%; float:right;">[[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3|'''Read the full newsletter''']]</span> ---- Welcome to the third issue of Universal Code of Conduct News! This newsletter will help Wikimedians stay involved with the development of the new code and will distribute relevant news, research, and upcoming events related to the UCoC. If you haven’t already, please remember to subscribe [[:m:Special:MyLanguage/Global message delivery/Targets/UCoC Newsletter Subscription|here]] if you would like to be notified about future editions of the newsletter, and also leave your username [[:m:Special:MyLanguage/Universal Code of Conduct/Newsletter/Participate|here]] if you’d like to be contacted to help with translations in the future. </div><div style="margin-top:3px; padding:10px 10px 10px 20px; background:#fffff; border:2px solid #808080; border-radius:4px; font-size:100%;"> *'''The Enforcement Draft Guidelines''' - The Enforcement Draft Guidelines for the Universal Code of Conduct has just been published on meta in different languages. These guidelines include some definitions of newly introduced terms and recommendations for local enforcement structures. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#The Enforcement Draft Guidelines|continue reading]]) *'''Enforcement Draft Guidelines Review''' - Before the enforcement guidelines are finalized, they must be reviewed and discussed by the community. The facilitation team has set up various discussion means throughout this review period. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Enforcement Draft Guidelines Review|continue reading]]) *'''Conversation Hours & Roundtables''' - To listen to community opinions and exchange ideas regarding enforcement draft guidelines proposed by the drafting committee, the UCoC facilitation team will be hosting weekly conversation hours. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Conversation Hours & Roundtables|continue reading]]) *'''Wikimania Wrap-up''' - The facilitation team hosted a Roundtable at Wikimania 2021, featuring some WMF trustees and staff. The session offered some insights on how the Enforcement Draft Guidelines came about, and what next steps are being imagined. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Wikimania Wrap-up|continue reading]]) *'''Translation''' - Because a considerable number of Wikimedians are not English speakers, and that UCoC applies to all members, projects across the wikimedia movement, it’s of a great importance to provide adequate language support throughout this process. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Translation|continue reading]]) *'''Diff blogs''' - Check out some interesting publications about the UCoC on Wikimedia Diff blog. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Diff Blogs|continue reading]]) *'''WMF's 2021 Board of Trustees election''' - Please read the Candidate Presentations and vote! ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/3#Wikimedia Foundation's Board of Trustees 2021 election|continue reading]]) <section end="ucoc-newsletter"/></div> [[Gebruiker:MNadzikiewicz (WMF)|MNadzikiewicz (WMF)]] ([[Gebruikerbespreking:MNadzikiewicz (WMF)|kontak]]) 22:22, 27 Augustus 2021 (UTC) == Universal Code of Conduct News – Issue 4 == <section begin="ucoc-newsletter"/> <div style = "line-height: 1.2"> <span style="font-size:200%;">'''Universal Code of Conduct News'''</span><br> <span style="font-size:120%; color:#404040;">'''Issue 4, October 2021'''</span><span style="font-size:120%; float:right;">[[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4|'''Read the full newsletter''']]</span> ---- Welcome to the fourth issue of Universal Code of Conduct News! This newsletter will help Wikimedians stay involved with the development of the new code and will distribute relevant news, research, and upcoming events related to the UCoC. If you haven’t already, please remember to subscribe [[:m:Special:MyLanguage/Global message delivery/Targets/UCoC Newsletter Subscription|here]] if you would like to be notified about future editions of the newsletter, and also leave your username [[:m:Special:MyLanguage/Universal Code of Conduct/Newsletter/Participate|here]] if you’d like to be contacted to help with translations in the future. </div><div style="margin-top:3px; padding:10px 10px 10px 20px; background:#fffff; border:2px solid #808080; border-radius:4px; font-size:100%;"> *'''Enforcement Draft Guidelines Review Wrap-up''' - The Universal Code of Conduct Enforcement Draft Guidelines Review will come to a close on 17 October 2021, after more than two months of extensive consultations. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4#Enforcement Draft Guidelines Review Wrap-up|continue reading]]) *'''Roundtable Discussions and Conversation Hours''' - Another successful roundtable session happened on September 18, 2021 to discuss the EDGR. One last conversation hour will be happening on October 15th, 2021. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4#Roundtable Discussions and Conversation Hours|continue reading]]) *'''Movement Charter Drafting Committee Elections''' - The Movement Charter Drafting Committee selection process has kicked off and will be open until October 25, 2021. Contributors to Wikimedia projects can elect their favorite candidates on to the committee. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4#Movement Charter Drafting Committee Elections|continue reading]]) *'''New Direction for the Newsletter''' - As we round-up the consultation processes for the Universal Code of Conduct, the facilitation team is currently envisioning new directions for the newsletter. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4#New Direction for the Newsletter|continue reading]]) *'''Diff Blogs''' - Check out the most recent publications about the UCoC on Wikimedia Diff. ([[m:Special:MyLanguage/Universal Code of Conduct/Newsletter/4#Diff Blogs|continue reading]]) </div><section end="ucoc-newsletter"/> [[Gebruiker:MNadzikiewicz (WMF)|MNadzikiewicz (WMF)]] ([[Gebruikerbespreking:MNadzikiewicz (WMF)|kontak]]) 20:31, 14 Oktober 2021 (UTC) == <span lang="en" dir="ltr" class="mw-content-ltr">Movement Strategy and Governance News – Issue 6</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="ucoc-newsletter"/> <div style = "line-height: 1.2"> <span style="font-size:200%;">'''Movement Strategy and Governance News'''</span><br> <span style="font-size:120%; color:#404040;">'''Issue 6, April 2022'''</span><span style="font-size:120%; float:right;">[[m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6|'''Read the full newsletter''']]</span> ---- Welcome to the sixth issue of Movement Strategy and Governance News! This revamped newsletter distributes relevant news and events about the Movement Charter, Universal Code of Conduct, Movement Strategy Implementation grants, Board of trustees elections and other relevant MSG topics. This Newsletter will be distributed quarterly, while the more frequent Updates will also be delivered weekly. Please remember to subscribe [[m:Special:MyLanguage/Global message delivery/Targets/MSG Newsletter Subscription|here]] if you would like to receive future issues of this newsletter. </div><div style="margin-top:3px; padding:10px 10px 10px 20px; background:#fffff; border:2px solid #808080; border-radius:4px; font-size:100%;"> *'''Leadership Development -''' A Working Group is Forming! - The application to join the Leadership Development Working Group closed on April 10th, 2022, and up to 12 community members will be selected to participate in the working group. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A1|continue reading]]) *'''Universal Code of Conduct Ratification Results are out! -''' The global decision process on the enforcement of the UCoC via SecurePoll was held from 7 to 21 March. Over 2,300 eligible voters from at least 128 different home projects submitted their opinions and comments. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A2|continue reading]]) *'''Movement Discussions on Hubs -''' The Global Conversation event on Regional and Thematic Hubs was held on Saturday, March 12, and was attended by 84 diverse Wikimedians from across the movement. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A3|continue reading]]) *'''Movement Strategy Grants Remain Open! -''' Since the start of the year, six proposals with a total value of about $80,000 USD have been approved. Do you have a movement strategy project idea? Reach out to us! ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A4|continue reading]]) *'''The Movement Charter Drafting Committee is All Set! -''' The Committee of fifteen members which was elected in October 2021, has agreed on the essential values and methods for its work, and has started to create the outline of the Movement Charter draft. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A5|continue reading]]) *'''Introducing Movement Strategy Weekly -''' Contribute and Subscribe! - The MSG team have just launched the updates portal, which is connected to the various Movement Strategy pages on Meta-wiki. Subscriber to get up-to-date news about the various ongoing projects. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A6|continue reading]]) *'''Diff Blogs -''' Check out the most recent publications about the UCoC on Wikimedia Diff. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/6#A7|continue reading]]) </div><section end="ucoc-newsletter"/> </div> Thanks for reading. [[User:Xeno (WMF)|Xeno (WMF)]] 02:24, 13 April 2022 (UTC) <!-- Message sent by User:Xeno (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Movement_Strategy_and_Governance/Newsletter/Subscribe&oldid=23137838 --> == <span lang="en" dir="ltr" class="mw-content-ltr">Movement Strategy and Governance News – Issue 7</span> == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin="msg-newsletter"/> <div style = "line-height: 1.2"> <span style="font-size:200%;">'''Movement Strategy and Governance News'''</span><br> <span style="font-size:120%; color:#404040;">'''Issue 7, July-September 2022'''</span><span style="font-size:120%; float:right;">[[m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7|'''Read the full newsletter''']]</span> ---- Welcome to the 7th issue of Movement Strategy and Governance News! The newsletter distributes relevant news and events about the implementation of Wikimedia's [[:m:Special:MyLanguage/Movement Strategy/Initiatives|Movement Strategy recommendations]], other relevant topics regarding Movement governance, as well as different projects and activities supported by the Movement Strategy and Governance (MSG) team of the Wikimedia Foundation. The MSG Newsletter is delivered quarterly, while the more frequent [[:m:Special:MyLanguage/Movement Strategy/Updates|Movement Strategy Weekly]] will be delivered weekly. Please remember to subscribe [[m:Special:MyLanguage/Global message delivery/Targets/MSG Newsletter Subscription|here]] if you would like to receive future issues of this newsletter. </div><div style="margin-top:3px; padding:10px 10px 10px 20px; background:#fffff; border:2px solid #808080; border-radius:4px; font-size:100%;"> * '''Movement sustainability''': Wikimedia Foundation's annual sustainability report has been published. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A1|continue reading]]) * '''Improving user experience''': recent improvements on the desktop interface for Wikimedia projects. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A2|continue reading]]) * '''Safety and inclusion''': updates on the revision process of the Universal Code of Conduct Enforcement Guidelines. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A3|continue reading]]) * '''Equity in decisionmaking''': reports from Hubs pilots conversations, recent progress from the Movement Charter Drafting Committee, and a new white paper for futures of participation in the Wikimedia movement. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A4|continue reading]]) * '''Stakeholders coordination''': launch of a helpdesk for Affiliates and volunteer communities working on content partnership. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A5|continue reading]]) * '''Leadership development''': updates on leadership projects by Wikimedia movement organizers in Brazil and Cape Verde. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A6|continue reading]]) * '''Internal knowledge management''': launch of a new portal for technical documentation and community resources. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A7|continue reading]]) * '''Innovate in free knowledge''': high-quality audiovisual resources for scientific experiments and a new toolkit to record oral transcripts. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A8|continue reading]]) * '''Evaluate, iterate, and adapt''': results from the Equity Landscape project pilot ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A9|continue reading]]) * '''Other news and updates''': a new forum to discuss Movement Strategy implementation, upcoming Wikimedia Foundation Board of Trustees election, a new podcast to discuss Movement Strategy, and change of personnel for the Foundation's Movement Strategy and Governance team. ([[:m:Special:MyLanguage/Movement Strategy and Governance/Newsletter/7#A10|continue reading]]) </div><section end="msg-newsletter"/> </div> [[User:RamzyM (WMF)|RamzyM (WMF)]] 01:39, 18 Julie 2022 (UTC) <!-- Message sent by User:RamzyM (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=Movement_Strategy_and_Governance/Newsletter/Subscribe&oldid=23527297 --> ag9yvd3p39gobo3tk47ou4zp5zm9fco Gebruikerbespreking:SHB2000 3 3383 6842 2021-08-08T01:39:28Z Pathoschild 29 global user pages ([[m:Synchbot|requested by SHB2000]]) 6842 wikitext text/x-wiki <div style="border: 1rem #dd0000 ridge; padding: 0.5em;">Hello! Please message me on [[m:User talk:SHB2000|meta.wikimedia.org]] instead. I may not notice messages on this page.</div> ojy2vkqs676esjrcfi79dwyt0tjr5xc Gebruikerbespreking:Yahya 3 3384 6845 2021-09-05T18:26:04Z Pathoschild 29 global user pages ([[m:Synchbot|requested by Yahya]]) 6845 wikitext text/x-wiki <div style="font-size:130%;font-family:Roboto,Arial; border-top:5px solid lightblue; border-bottom:5px solid lightblue; padding:5px;margin-top:20px;">Hello! Please message me on [[m:User talk:Yahya|meta.wikimedia.org]] instead. I may not notice messages on this page.</div> c4ypm7wbt5rvjqqxzie5ujk3hmhcrrp Boekrak:Kuns 0 3386 6870 2021-11-23T18:01:23Z Riaan Dewee 2348 Riaan Dewee 6870 wikitext text/x-wiki Ek' Riaan Dewee en wil graag deel wees van hierdie bladsy. 4prsw72ujfzh2tw3u0zajrtnukuchyp Rooibos Tee - Ice Tea 0 3387 7271 6885 2023-07-23T09:42:46Z 160.226.137.24 7271 wikitext text/x-wiki ROOIBOS YSTEE '''Bestanddele''': 💧8 Liter water 💧10 Rooibos tee sakkies 💧½ bottel halls grandadella stroop '''So gemaak''': Kook Water en tee laat dit lekker trek. Haal af van stoof en voeg stroop by. Roer goed deur. Laat af koel en plaas in bottels en bêre in yskas baie lekker vir warm dae. Geniet!! dreq887nmnvytasyx0o7knq606tyuia Rooibostee Pons 0 3388 6888 2021-12-11T15:03:23Z Grigoz1 2342 Nuwe bladsy geskep met 'ROOIBOSTEE PONS (Hierdie resep rek die koeldrank en dit is ook baie gesond!) '''Bestanddele''': 💧1 liter koue rooibostee 💧1 liter vrugtesap 💧1 liter Sprite (of ander gaskoeldrank van jou keuse.) 💧1 klein blikkie vrugte (opsioneel – soos gemengde vrugte of pynappelstukke) '''So gemaak:''' Meng saam en bedien met ys. (Gaskoeldrank kan uitgelaat word en rooibostee vermeerder word.)' 6888 wikitext text/x-wiki ROOIBOSTEE PONS (Hierdie resep rek die koeldrank en dit is ook baie gesond!) '''Bestanddele''': 💧1 liter koue rooibostee 💧1 liter vrugtesap 💧1 liter Sprite (of ander gaskoeldrank van jou keuse.) 💧1 klein blikkie vrugte (opsioneel – soos gemengde vrugte of pynappelstukke) '''So gemaak:''' Meng saam en bedien met ys. (Gaskoeldrank kan uitgelaat word en rooibostee vermeerder word.) 87ntet6ne9zctawdn4ai7u74a3kynyc Piesang Broodjie 0 3389 7270 7131 2023-07-23T09:38:41Z 160.226.137.24 /* Bestanddele: */ 7270 wikitext text/x-wiki '''<u>Piesang Broodjie</u>''' [[File:Banana bread without nuts plus strawberries.JPG]] '''“maak 1 broodjie”''' ==Bestanddele:== ▪ 1 k wit suiker ▪ ½ k sagte botter ▪ 3 ryp piesangs fyn gedruk ▪ 2 eiers ▪ 2 k veelsydige meel ▪ ½ tl koeksoda ▪ ⅓ k suurmelk (amazi) ▪ ¼ tl sout (knypie) ▪ 1 tl vanilje geursel ==Metode:== Verhit oond tot 180°C. Smeer ń 20cm×10cm broodpan. Meng saam al die bestanddele in ń mengbak - meng goed. Gooi mengsel in broodpan. Bak op middelrak vir 60min. t1unchcn9asos11iio3f8y8v4bzup7d Koffiesoentjies 0 3390 7125 6897 2021-12-21T22:36:54Z Grigoz1 2342 7125 wikitext text/x-wiki '''<u>KOFFIESOENTJIES</u>''' ==Bestanddele:== ☕250 g sagte botter ☕185 ml versiersuiker, gesif ☕10 ml koffiepoeier ☕15 ml kookwater ☕500 ml koekmeel, gesif '''Vulsel''': 🍫50 g (½ slab) donkersjokola, gesmelt. ==Metode:== Stel oond op 180 °C. 1. Room botter en versiersuiker tot liggeel. 2. Roer koffiepoeier en kookwater saam en giet by bottermengsel. Klits goed. 3. Roer koekmeel by bottermengsel. Dit sal sagte deeg wees. 4. Voer bakplaat met bakpapier uit. 5. Skep deeg in spuitsak met meduim- grootte sterretjie-spuitpunt 6. Maak sirkeltjies van ongeveer 2 cm op bakplaat, maar nie te naby aan mekaar nie. 7. Bak vir 10 min of tot effe ligbruin. Laat op afkoelrakkie afkoel. 8. Plaas twee koekies opmekaar met bietjie gesmelte sjokola. 1wvrqx4hfb7arl8fafln5m8fx58y9n4 Gebruiker:Ruslik0 2 3391 6899 2021-12-11T19:27:19Z 41.138.89.241 Nuwe bladsy geskep met 'BAzAz' 6899 wikitext text/x-wiki BAzAz 4gjtxa6c62vupd6refww08hnlnl2pjv Koeksisters 0 3392 7128 7127 2021-12-21T22:49:54Z Grigoz1 2342 7128 wikitext text/x-wiki KOEKSISTERS [[Lêer:Koeksisters.jpg|duimnael|regs|260px|Koeksisters]] ''groot maat'' ==STROOP:== (moet yskoud wees) 🍯20 koppies suiker (wit) 🍯10 koppies water '''So gemaak''': Kook tot suiker opgelos is. Laat afkoel en plaas in yskas om yskoud te word. ==DEEG:== 🍯6 koppies koekmeel 🍯6 eetlepels maizina hoogvol 🍯6 eetlepels bakpoeier hoogvol 🍯1 teelepels sout 🍯3 eiers 🍯100 gr botter 🍯3 koppies water '''Metode''': Vryf botter in droë bestanddele in. Kilts eiers en water saam. Meng alles goed. Rol uit, vleg en bak. ==Afronding:== Sit gaar gebakte koeksister "terwyl nog warm" in koue stroop. 52bh69ygeue16cc3zfx3jk0pncus003 Fudge 0 3393 7262 7261 2023-07-23T09:09:00Z 160.226.137.24 /* Alles Fudge */ 7262 wikitext text/x-wiki Hier is ń paar lekker fudge resepte, asb. wees vry en voeg by. == Alles Fudge == [[BarOne fudge]] [[Beskuitjie Sjokola Fudge]] [[fudge 1]] [[Grondboontjiebotter en Klapper Fudge]] [[Klapper Fudge]] [[Marie Beskuitjie Fudge]] [[Neute Fudge]] [[Sjokola Fudge]] 9rezjqhhef8pb5pp1fpxrp0ljix8tw6 Grondboontjiebotter en Klapper Fudge 0 3394 7087 6908 2021-12-18T11:30:23Z Grigoz1 2342 7087 wikitext text/x-wiki Grondboontjiebotter en klapper fudge ==Bestanddele:== 500g wit of bruin suiker 1 × 270g sagte Grondboontjiebotter 200g botter 200ml melk 150g klapper, plus bietjie ekstra 1 pakkie Mariebeskuitjies, grof fyn gemaak ==Metode:== Smelt botter in ‘n diep kastrol oor lae hitte. Voeg suiker by en hou aan roer tot suiker net gesmelt is. Voeg Grondboontjiebotter by, met helfde van die melk -100ml. Roer goed deur en bring tot kookpunt. Voeg res van die melk by, roer deur en verwyder van hitte. Voeg klapper en gekrummelde koekies by, meng goed deur. Laat mengsel effe afkoel. In ‘n langwerpige glasbak, giet mengsel in en maak eweredig. Strooi klapper oor en plaas in yskas om goed af te koel. Sny in klein blokke en geniet. ==Wenk:== Bêre in lugdigte houer in yskas. l25vjwhqf9azn3bz83w9pknm7ysbjc2 Oats Koekies 0 3395 7124 6913 2021-12-21T22:20:37Z Grigoz1 2342 Kiekie bygevoeg 7124 wikitext text/x-wiki '''Oats Koekies''' [[File:ANZAC biscuits.JPG]] == BESTANDDELE: == 🌾2 k meel 🌾4 k oats 🌾2 k klapper 🌾2 k suiker 🌾250 g margarien 🌾3 el stroop 🌾2 tl koeksoda == METODE: == Smelt botter & stroop. (moenie kook nie net smelt) Voeg koeksoda by. Meng die droë bestanddele saam. Gooi stroop by droë bestanddele. Gooi in ‘n oondpan en druk vas. Bak vir ± 10~15 min teen 180°C. Haal uit en sny dadelik. rwuhxypya0s7to2n4srbwwk7pci84mf Sjokola - koppie 0 3396 7264 7263 2023-07-23T09:20:39Z 160.226.137.24 /* Beslag: */ 7264 wikitext text/x-wiki '''7''' '''Stappe tot 'n heerlike sjokolade-koppie''' Mediese navorsers het bewys dat sjokolade 'n opkikker is. Dus is dit 'n briljante idee om dié bevindinge ter harte te neem en hierdie sjokolade-koppie op die proef te stel. Almal geniet sjokolade en selfs die wat sê hulle eet dit nie, sê nooit nee wanneer hul 'n blokkie of twee aangebied word nie. Dis 'n mikrogolfoond-resep, wat slegs vier minute neem om te maak. '''Maak''': 2 koppies '''Bereidingstyd''': 2-5 min. '''Baktyd''': 3 min. '''Benodig''': 2 koppies (200ml elk) uitgesmeer met botter of olie. == Beslag: == • 100ml suiker • 100ml koekmeel • 75ml melk • 75ml olie/botter • 50ml kakao • 1 eier • 2 druppels Vanilla of Karamelgeursel • Knippie sout '''Opsioneel''': 75ml Choc-chips of een fyngemaakte piesang == Versiersel: == • 100ml drinksjokoladepoeier of kakao en suiker • 100ml water • 5ml Maizena == Metode: == # Klop die eier, sout en suiker saam. # Meng die melk en olie in 'n ander bak saam. # Meng die eier-suikermengsel saam met die olie-melkmengsel en vou die koekmeel en kakao met 'n vurk in. # Deel beslag in die koppies. # Plaas in mikrogolfoond en bak vir 3 min. op hoog. Moenie die bakproses onderbreek nie. Laat staan vir 'n minuut en haal dan uit. # Versiersel: Meng sjokoladepoeier, water en Maizena saam en kook vir 20 sekondes op hoog, roer, en kook weer vir 20 sekondes. # Gooi die versiersel bo-oor die koek in die koppie. Die koek kan ook uitgedop word in 'n kleinbordjie en so opgedien word met die versiersel bo-oor. Roomys kan bybedien word. nqfyfee1pdy7xr1cj8g2qbgr26hifn9 Rice Krispie Koekies 0 3397 7121 6923 2021-12-21T21:41:12Z Grigoz1 2342 Kiekie bygevoeg 7121 wikitext text/x-wiki '''Rice Krispie Koekies''' [[File:RKTsquares.jpg]] ==Bestanddele:== ⚫¼ k margarien ⚫25 Marshmallows ⚫1 tl Vanilla geursel ⚫5 k Rice Krispies ==Metode:== # Smelt margarien in 'n kastrol. # Voeg Marshmallows by, en smelt oor lae hitte. # Haal van plaat af. # Voeg Vanilla geursel by. # Meng Rice Krispies by. # Druk die mengsel plat in 'n vierkantige bak (met 'n natgemaakte houtlepel). # Laat staan 30 minute & sny in blokkies. ga9qxmimayo6uk4ty5ie17x16lse7ot Pons 0 3398 6934 6932 2021-12-12T03:14:01Z Grigoz1 2342 6934 wikitext text/x-wiki [[Rooibostee Pons]] [[Gin en witwyn pons]] [[Bessie pons]] [[Vrugte slaai Pons]] h5s6zcs2xe62g16vf0xbkcojfg14iqu Gin en witwyn pons 0 3399 6931 2021-12-12T03:00:13Z Grigoz1 2342 Nuwe bladsy geskep met 'BLITS VINNIGE PONS '''Bestanddele''': 💧375 ml gin 💧750 ml wit wyn 💧750 ml Oros 💧375 ml lemmetjiesap (bv Roses) 💧6 liter lemonade 💧1 blikkie grenadellamoes 💧825g-blik pere 💧825g-blik perskes 💧825g-blik pynappelstukke '''Maak so:''' Voeg res van bestanddele behalwe lemonade, oros en lemmetjiesap by. Laat oornag in gin en witwyn lê. Voeg lemonade, Oros en die lemmetjiesap net voor opdiening by.' 6931 wikitext text/x-wiki BLITS VINNIGE PONS '''Bestanddele''': 💧375 ml gin 💧750 ml wit wyn 💧750 ml Oros 💧375 ml lemmetjiesap (bv Roses) 💧6 liter lemonade 💧1 blikkie grenadellamoes 💧825g-blik pere 💧825g-blik perskes 💧825g-blik pynappelstukke '''Maak so:''' Voeg res van bestanddele behalwe lemonade, oros en lemmetjiesap by. Laat oornag in gin en witwyn lê. Voeg lemonade, Oros en die lemmetjiesap net voor opdiening by. mubx5da72r9hb9c69fmk94ojvswrrrw Bessie pons 0 3400 6933 2021-12-12T03:08:26Z Grigoz1 2342 Nuwe bladsy geskep met 'BESSIE BESSIE PONS '''Bestanddele:''' 💧500 ml Droë witwyn 💧250 ml Rosé wyn 💧500 ml Limonade 💧250ml Gemmerlim “ginger ale” 💧250 g aarbeie “strawberry” 💧250g bloubessies 💧250 g frambose “raspberry” 💧takies vars kruisement '''Metode:''' Meng al die bestanddele in n beker. Vries die bessies en gebruik dit sommer as die ysblokkies. Jy kan die wyn met nog limonade vervang.' 6933 wikitext text/x-wiki BESSIE BESSIE PONS '''Bestanddele:''' 💧500 ml Droë witwyn 💧250 ml Rosé wyn 💧500 ml Limonade 💧250ml Gemmerlim “ginger ale” 💧250 g aarbeie “strawberry” 💧250g bloubessies 💧250 g frambose “raspberry” 💧takies vars kruisement '''Metode:''' Meng al die bestanddele in n beker. Vries die bessies en gebruik dit sommer as die ysblokkies. Jy kan die wyn met nog limonade vervang. j4jgi3rt6mbpmmecvdoba5drqwwjt7e Vrugte slaai Pons 0 3401 6935 2021-12-12T03:16:34Z Grigoz1 2342 Nuwe bladsy geskep met 'VRUGTE SLAAI PONS '''Bestanddele:''' 💧2 koppies lemoensap 💧2 eetlepels grenadellamoes 💧3 koppies water 💧1 koppie pynappelsap 💧Sap van 2 suurlemoene 💧Suiker na smaak '''METODE:''' Meng al die bestanddele baie goed en laat goed koud word. Versier elke glasie met `n kruisementspruitjie.' 6935 wikitext text/x-wiki VRUGTE SLAAI PONS '''Bestanddele:''' 💧2 koppies lemoensap 💧2 eetlepels grenadellamoes 💧3 koppies water 💧1 koppie pynappelsap 💧Sap van 2 suurlemoene 💧Suiker na smaak '''METODE:''' Meng al die bestanddele baie goed en laat goed koud word. Versier elke glasie met `n kruisementspruitjie. c63n8v4dfy4trxihqvzg0medfmop90z Aartappel sop 0 3402 6939 2021-12-12T03:40:16Z Grigoz1 2342 Nuwe bladsy geskep met 'Maklik, vinnig en heerlik. == Bestanddele: == 1 groot ui fyngekap, 🥘 1 tl knoffel, 1 pakkie bacon fyngesny, 6 groot aartappels in klein blokkies gesny == Metode: == * braai als saam tot bruin * Voeg 1liter hoenderaftreksel by en kook tot sag * liquidize tot glad * voeg knypie nutmeg en 1k melk by * prut saggies vir 10min * voeg halwe koppie room by voor opdienning == Variasie: == sit gestoomde brokkoli / spinasie by sop voor jy dit liquidize' 6939 wikitext text/x-wiki Maklik, vinnig en heerlik. == Bestanddele: == 1 groot ui fyngekap, 🥘 1 tl knoffel, 1 pakkie bacon fyngesny, 6 groot aartappels in klein blokkies gesny == Metode: == * braai als saam tot bruin * Voeg 1liter hoenderaftreksel by en kook tot sag * liquidize tot glad * voeg knypie nutmeg en 1k melk by * prut saggies vir 10min * voeg halwe koppie room by voor opdienning == Variasie: == sit gestoomde brokkoli / spinasie by sop voor jy dit liquidize lr4mcga2nyqghjmizi2wzbtardxu5fw Beesstert sop 0 3403 6942 2021-12-12T04:01:15Z Grigoz1 2342 Nuwe bladsy geskep met 'Hierdie Beesstert sop is eerlikwaar ’n maaltyd op sy eie. Begin al die vorige dag daarmee. == Jy benodig: == 🐂500 g beesstert 🐂30 ml sonneblomolie 🐂1 ui, gekap 🐂2 wortels, in die lengte gehalveer en in skywe gesny 🐂1 groot selderystingel, in stukkies gesny 🐂6 tamaties, in blokkies gesny 🐂750 ml water 🐂15 ml Worcestersous 🐂1 lourierblaar 🐂sout en varsgemaalde swartpeper na smaak == Maak so: == Verhit jou oond tot 140°C. Pla...' 6942 wikitext text/x-wiki Hierdie Beesstert sop is eerlikwaar ’n maaltyd op sy eie. Begin al die vorige dag daarmee. == Jy benodig: == 🐂500 g beesstert 🐂30 ml sonneblomolie 🐂1 ui, gekap 🐂2 wortels, in die lengte gehalveer en in skywe gesny 🐂1 groot selderystingel, in stukkies gesny 🐂6 tamaties, in blokkies gesny 🐂750 ml water 🐂15 ml Worcestersous 🐂1 lourierblaar 🐂sout en varsgemaalde swartpeper na smaak == Maak so: == Verhit jou oond tot 140°C. Plaas beesstert in ’n kastrol. Maak toe met deksel en plaas in die oond vir minstens 4 uur. Haal uit en laat afkoel. Verwyder vleis van die bene en verwyder oortollige stukke vet. Behou die bene. Verhit olie in ’n kastrol. Braai ui, wortels en seldery saam vir sowat 10 minute. Gooi tamaties by en braai verder vir sowat 5 minute. Gooi vleis, bene en die jellie (wat vorm as die vleis afkoel) by. Voeg water, lourierblaar en Worcestersous by. Geur met sout en swartpeper. Maak kastrol toe met ’n deksel en laat stadig prut vir minstens 4 uur. Roer elke nou en dan. As jou sop te dik kook, kan jy nog ’n klein bietjie water byvoeg, maar onthou, dit moet lekker dik wees. swsqc0nsjyecwackjnrnxo08n068w7y Beesvleis met Bruin Uiesop 0 3404 6945 6944 2021-12-12T04:17:34Z Grigoz1 2342 6945 wikitext text/x-wiki Hierdie wonder lekker sop bevat geen water nie. == Bestanddele: == 🐂1 kg beeskrisket 🐂1,5 kg aartappels 🐂500g wortels 🐂2 uie gekap 🐂1 pakkie bruinuiesoppoeier 🐂100ml worcestersous 🐂1 kop bevrore ertjies 🐂250g sampioene (net so heel) == Metode: == Pak vleis onder in “slowcooker”. Gooi droë uiesoppoeier oor en daarna die worcestersous. Pak aartappels en wortels bo-op die vleis. Sit “slowcooker” op laag en kook vir 8 ure. <sup>'''''Merk'''''</sup> – geen water nie. Die 100 ml wostersous en vog van die vleis is genoeg. Half uur na uur voor ete, stel na hoog, gooi koppie bevrore ertjies en sampioene by en indien nodig verdik met bisto. – Kook deur vir half uur of so. Bedien met rys of stampmielies. 3j5gkxozv9g8ej66m9bgbd64s3mvggs Blaarslaai sop 0 3405 6947 2021-12-12T04:24:52Z Grigoz1 2342 Nuwe bladsy geskep met 'BLAARSLAAI SOP == Bestanddele: == ❄500 ml (2k) room ❄3 liter melk ❄750 ml (3k) kookwater ❄1½ ui ❄1 eetlepel olyfolie ❄2 pakkies repies spek ❄3 groot aartappels – grof gerasper ❄1½ kop blaarslaai ❄2 pakkies hoender roomsop ❄Hoenderaftreksel blokkie – aangemaak met water == Metode: == Kook melk en water saam. Gooi aartappels by en kook tot sag. Braai uie apart in olyfolie. Braai repies spek in dieselfde olie. Gooi uie en spek in me...' 6947 wikitext text/x-wiki BLAARSLAAI SOP == Bestanddele: == ❄500 ml (2k) room ❄3 liter melk ❄750 ml (3k) kookwater ❄1½ ui ❄1 eetlepel olyfolie ❄2 pakkies repies spek ❄3 groot aartappels – grof gerasper ❄1½ kop blaarslaai ❄2 pakkies hoender roomsop ❄Hoenderaftreksel blokkie – aangemaak met water == Metode: == Kook melk en water saam. Gooi aartappels by en kook tot sag. Braai uie apart in olyfolie. Braai repies spek in dieselfde olie. Gooi uie en spek in melk en kook. Gooi ook blaarslaai by. Voeg hoenderaftreksel by en laastens die room. Kook vir sowat 1 uur. o8atbpwjfszxzoqq5uc5qkx19dcm7mt Boontjie sop 0 3406 6972 6971 2021-12-12T12:36:51Z Grigoz1 2342 6972 wikitext text/x-wiki BOONTJIESOP == Bestanddele: == 1 sakkie (500g) suikerbone 3 liter kookwater 500~800g bees of skaapskenkels of -stowevleis (of albei) 1 groot ui, gekap 1 biefblokkie 1 blikkie (65g) tamatiepasta 25 ml (1el + 2tl)Bisto 15ml (1el)Worcestersous sout en peper == Metode: == Week boontjies oornag in baie koue water. Die volgende dag: was en dreineer boontjies en kook dan met 2 liter van die kookwater tot sag. Braai ui en vleis bietjie bruin en kook dan met orige 1 liter kookwater tot baie sag. (‘n Drukkoker/stoompot is baie handig!) Verwyder die bene en sny vleis in kleiner stukkies en voeg saam met die vleissous en biefblokkie by die boontjies. Meng die tamatiepasta, Bisto en Worcestersous met bietjie koue water en roer by die sop in – geur met sout en peper. Laat dit goed deurkook en bedien warm. ==Ander Boontjie Sop Resepte== [[Boontjie sop met spekblokkies]] [[Heerlike Boontjies sop]] ldkiwkt9fp9aclmfaul75h0s74n5ocd Boontjie sop met spekblokkies 0 3407 6951 2021-12-12T04:52:22Z Grigoz1 2342 Nuwe bladsy geskep met 'Jy kan die vark vervang met bees, droë hoender stukke of skaap vleis. == Bestanddele: == 🌱500g pakkie droë suikerbone, 🌱250g gerookte spek, in blokkies gesny oornag geweek in koue water. 🌱2.5 liter water 1 groot ui gekap 🌱1 wortel, grof gerasper 65g (1blikkie) tamatiepasta 🌱2 lourierblare 6 wonderpeperkorrels 🌱3 kruienaeltjies ‘n paar gekapte takkies pietersielie 🌱10ml (2tl) bruinasyn sout en varsgemaalde swartpeper 🌱2 knoffelhuis...' 6951 wikitext text/x-wiki Jy kan die vark vervang met bees, droë hoender stukke of skaap vleis. == Bestanddele: == 🌱500g pakkie droë suikerbone, 🌱250g gerookte spek, in blokkies gesny oornag geweek in koue water. 🌱2.5 liter water 1 groot ui gekap 🌱1 wortel, grof gerasper 65g (1blikkie) tamatiepasta 🌱2 lourierblare 6 wonderpeperkorrels 🌱3 kruienaeltjies ‘n paar gekapte takkies pietersielie 🌱10ml (2tl) bruinasyn sout en varsgemaalde swartpeper 🌱2 knoffelhuisies skoongemaak olyfolie == Metode: == Spoel bone af onder koue water en dreineer. Dompel varkpootjie vinnig in kookwater en was goed af. Skep spek in ‘n groot kastrol en braai oor lae hitte tot bros. Skep uit. Braai varkpootjie in dieselfde kastrol tot bruin alkante. Skep bone by varkpootjie in kastrol en voeg water by. Verhit tot kookpunt, en skep skuim af met gaatjieslepel. Voeg res van bestanddele tot em met bruinasyn by, verhit tot kookpunt, verlaag hitte en laat stadig prut met deksel op kastrol vir sowat 2½-3 ure of tot bone sag is. Geur na smaak met sout en swartpeper. Verwyder varkpootjie en druk sommige van die bone fyn met ‘n aartappeldrukker. 3hspma3qu4ezycapk31sd8uc2kat6q6 Botterskorsie sop 0 3408 6953 2021-12-12T04:59:34Z Grigoz1 2342 Nuwe bladsy geskep met 'BOTTERSKORSIE SOP == Bestanddele: == 700 g botterskorsie ( butternut) 1 ui, gekap 3 aartappels, in blokkies 1,25 liter hoenderaftreksel sout en peper na smaak 125 ml room of melk == METODE: == Braai die ui en voeg die aartappel, butternut en tarragon by. Braai vir ‘n klein rukkie. Voeg dan die hoenderaftreksel by en kook tot die groente sag is. Versap in voedsel verwerker en geur na smaak. Voeg die room of melk by net voor opdiening.' 6953 wikitext text/x-wiki BOTTERSKORSIE SOP == Bestanddele: == 700 g botterskorsie ( butternut) 1 ui, gekap 3 aartappels, in blokkies 1,25 liter hoenderaftreksel sout en peper na smaak 125 ml room of melk == METODE: == Braai die ui en voeg die aartappel, butternut en tarragon by. Braai vir ‘n klein rukkie. Voeg dan die hoenderaftreksel by en kook tot die groente sag is. Versap in voedsel verwerker en geur na smaak. Voeg die room of melk by net voor opdiening. ldfplzg4pvsy4k4o8i4twndy5cxuyxx Bielie Mielie 0 3409 6967 6966 2021-12-12T09:25:35Z Grigoz1 2342 6967 wikitext text/x-wiki Hierdie Bielie Mielie is sommer ń lekka volmaag ontbyt! As jy so lus kry kan jy dit as ń middagete ook geniet. == ''vir die'' '''Stywepap:''' == '''Jy benodig''': 🌽2 kop mieliemeel 🌽3 kop water 🌽1 tl sout == Metode: == Gebruik ‘n swaarboompot. Voeg water in pot en bring tot kookpunt, voeg sout by. Voeg die mieliemeel stadig by en roer heeltyd met ‘n papvurk totdat die pap styf is. Sit deksel op, draai hitte op laagste stelling, laat dit vir 45 min stadig stoom. Roer af en toe goed deur. == ''vir die'' '''Vulsel:''' == '''Jy benodig''': 🐂2 Blikkies “Bully Beef" 🐂2 groot uie – opgekap 🐂1 groot ryp tamatie – opgekap 🐂1 tl kerriepoeier 🐂80ml (5el + 1tl)kookolie 🐂eiers – 1 per bakkie 🐂cheddar kaas – gerasper 🐂sout en peper na smaak 🐂botter == Metode: == Voorverhit oond 180°C. '''VULSEL''': Verhit olie en braai uie tot geurig, voeg kerriepoeier by en roer vinnig deur. Sny “corned beef” in blokkies en voeg by gebraaide uie, roerbraai vinnig deur. Voeg tamatie by en braai lekker saam, hou eenkant. == Finaal: == Berei jou oondvaste bakkies voor deur met bietjie bottter te smeer. Skep so 2 el vol vleismengsel in elke bakkie. Skep nou ¾ vol met gaar stywepap, laat effe afkoel. Skep vleismengsel bo op stywepap tot amper vol. Met ‘n botter gesmeerde eetlepel maak ‘n lekker diep holte in die middel van die pap. Breek ‘n eier in elke holte. Sprinkel met kaas. Bak in voorverhitte oond tot goudbruin en eier gestol. Verwyder van oond, laat rus vir 10 min voor bedien. == Wenk: == Slappap – 1 koppie meel, 3 koppies water Stywe pap – 2 koppies meel, 3 koppies water Krummelpap – 3 koppies meel, 3 koppies water p9wrthn9ktxofhmf07om7zba876flqz Blikkies sop 0 3410 6969 2021-12-12T12:06:30Z Grigoz1 2342 Nuwe bladsy geskep met 'Heerlike vinnig en maklike lui mens sop. == Jy Benodig: == ❄2 x blikkies tamatiesop ❄1 x blikkie hoendersop ❄1 x blikkie sampioensop ❄1 x pakkie spek, gesnipper ❄1 x ui, fyngekap ❄Melk om te verdun, indien nodig == So gedoen: == Braai bacon en ui in ‘n kastrol. Gooi al die blikkies sop by, meng goed, bring tot kookpunt. Stel hitte laer en laat simmer so 30 min. Dit klink nie great nie, maar glo my, dis watertand lekker!' 6969 wikitext text/x-wiki Heerlike vinnig en maklike lui mens sop. == Jy Benodig: == ❄2 x blikkies tamatiesop ❄1 x blikkie hoendersop ❄1 x blikkie sampioensop ❄1 x pakkie spek, gesnipper ❄1 x ui, fyngekap ❄Melk om te verdun, indien nodig == So gedoen: == Braai bacon en ui in ‘n kastrol. Gooi al die blikkies sop by, meng goed, bring tot kookpunt. Stel hitte laer en laat simmer so 30 min. Dit klink nie great nie, maar glo my, dis watertand lekker! b1p26qo8xzq2jksz9arrvt2gtss2od5 Heerlike Boontjies sop 0 3411 6973 2021-12-12T12:42:49Z Grigoz1 2342 Nuwe bladsy geskep met ' == Bestanddele: == ⚪1 pakkie gemengde sopbone oornag gelê in water ⚪2x uie ⚪2 pakke gesnipperde spek ⚪1 oxo hoenderblokkie ⚪2 pakkies wit uie sop ⚪500g sopvleis ⚪sout en witpeper na smaak == Metode: == Braai uie en spek tot sag, gooi saam boontjies, oxo blokkie en witpeper in genoeg water, laat heeldag staan as j kan simmer, kook intussen jou sopvleis apart tot sag. So halfuur voor sop opdien gooi sopvleis en wit uie sop saam boontjie mengsel.' 6973 wikitext text/x-wiki == Bestanddele: == ⚪1 pakkie gemengde sopbone oornag gelê in water ⚪2x uie ⚪2 pakke gesnipperde spek ⚪1 oxo hoenderblokkie ⚪2 pakkies wit uie sop ⚪500g sopvleis ⚪sout en witpeper na smaak == Metode: == Braai uie en spek tot sag, gooi saam boontjies, oxo blokkie en witpeper in genoeg water, laat heeldag staan as j kan simmer, kook intussen jou sopvleis apart tot sag. So halfuur voor sop opdien gooi sopvleis en wit uie sop saam boontjie mengsel. 26d72b0ur6gvmxm9lf8x8lduhnnbqhj Ertjie sop 0 3412 6976 2021-12-12T12:58:04Z Grigoz1 2342 Nuwe bladsy geskep met 'Nie vark etende mense is vry om ander vleis te gebruik. == Bestanddele: == ★1kg gevriesde ertjies ★5 aartapels ★2 pakke spek ★250ml (1k) room ★Sout ★Peper == Metode: == Kook ertjies tot sag sowel as aartapels wat gesny is. Braai spek en in ń pan tot lekker bruin. Maak die ertjie en aartapels mengsel dun tot ń puree, voeg jou spek/uie,room,sout en peper by en laat dit prut vir so 10min. As dit te dun is voeg melk by.' 6976 wikitext text/x-wiki Nie vark etende mense is vry om ander vleis te gebruik. == Bestanddele: == ★1kg gevriesde ertjies ★5 aartapels ★2 pakke spek ★250ml (1k) room ★Sout ★Peper == Metode: == Kook ertjies tot sag sowel as aartapels wat gesny is. Braai spek en in ń pan tot lekker bruin. Maak die ertjie en aartapels mengsel dun tot ń puree, voeg jou spek/uie,room,sout en peper by en laat dit prut vir so 10min. As dit te dun is voeg melk by. c2fyrz0y00zpt09yuosnameanajloy9 Groente sop 0 3413 6978 2021-12-12T13:07:42Z Grigoz1 2342 Nuwe bladsy geskep met 'GROENTE SOP == Bestanddele: == 🌱500g lamsvleis/beesvleis (lekker bene vleis) 🌱1 ½ kp droë sopmengsel (Lensies, ertjies of gemeng ens) 🌱2 liter kook water 🌱1 blik geskilde tamaties 🌱1 groot ui fyn gekap 🌱2 aartappels gerasper 🌱4 wortels gerasper 🌱1 ½ kop gekapte seldery 🌱½ kop ‘leeks’ (preie) opsioneel 🌱1 pakkie groentesop poeier 🌱sout, peper en worcestersous na smaak 🌱Ander kruie soos pietersielie ens na smaak...' 6978 wikitext text/x-wiki GROENTE SOP == Bestanddele: == 🌱500g lamsvleis/beesvleis (lekker bene vleis) 🌱1 ½ kp droë sopmengsel (Lensies, ertjies of gemeng ens) 🌱2 liter kook water 🌱1 blik geskilde tamaties 🌱1 groot ui fyn gekap 🌱2 aartappels gerasper 🌱4 wortels gerasper 🌱1 ½ kop gekapte seldery 🌱½ kop ‘leeks’ (preie) opsioneel 🌱1 pakkie groentesop poeier 🌱sout, peper en worcestersous na smaak 🌱Ander kruie soos pietersielie ens na smaak Jy kan ook jou groente in blokkies sny as jy ‘n growwe dik sop wil hê. == Metode: == Plaas al die groente en sopmengsel in die “slow cooker” en sit die vleis bo-op. Maak die soppoeier aan met water en gooi oor die vleis en groente. Sit die “slow cooker” op “LOW” en laat dit prut deur die nag vir ongeveer 10 ure. Of sit die “slow cooker” op “AUTO” voor jy werk toe gaan en die sop sal na 8 ure reg wees. Indien jy meer geurmiddels verkies, sit dit by voor opdiening. 4p8p1ybutf65ylng97cuwa5tuhj0lhc Lensie sop 0 3414 7119 6980 2021-12-21T20:12:40Z Grigoz1 2342 Kiekie bygevoeg 7119 wikitext text/x-wiki [[File:Bowl of lentil soup with green and red lentils.jpg]] == Bestanddele: == ❄6 repies spek, gekap ❄2/3 koppie gekapte ui ❄1 koppie lensies, afgespoel ❄500gr bevrore gemengde groente (veggie mix) of paar aartappels en wortels in skywe en blokkies gesny ❄5 ½ koppies water ❄1/2 teelepel droë basiliekruid ❄1 eetlepel sjerrie ❄1 ½ teelepel sout == Metode: == Ek voeg ook by so paar stukkies seldery. Braai spek en uie in ‘n groot pot oor medium-hoë hitte, roer af en toe, 5 tot 8 minute tot die uie sag is. Roer lensies, groente, water, en basil by. Bring tot kookpunt, verminder hitte en prut, 40min to 1uur of tot groente en lensies sag is. Roer sjerrie en sout by. Verdik indien nodig. fgod9nbx58lleubiy3cijwxqwh8ml7g Sampioen sop 0 3415 6990 6989 2021-12-12T14:40:25Z Grigoz1 2342 6990 wikitext text/x-wiki [[Sampioen Sop]] [[Sampioen Gortsop]] o1a1zvasv2fxhfgaa7s4scy6wo8k9ok Sampioen Gortsop 0 3416 6992 6991 2021-12-12T14:44:24Z Grigoz1 2342 6992 wikitext text/x-wiki SAMPIOEN🍄GORTSOP ( 4 PORSIES ) WENK- die gort kan vervang word met lensies, boontjies of 4in1sopmengsel. == Bestanddele: == 🍄 30ml (2 e) olyfolie 🍄 1 yf, gekap 🍄 2 knoffelhuisies, fyngedruk 🍄 300g Gemengde sampioene, in stukke gesny 🍄 2 stele seldery, gekap 🍄 2 wortels, geskil en in blokkies gesny 🍄 4 takkies tiemie 🍄 15ml (1 e) meel 🍄 375ml (1.5 k) gort 🍄 4×250ml (4 k) groenteaftreksel 🍄 1/2 suurlemoen se sap en gerasperde skil 🍄 sout en vars gemaalde peper 🍄 10g pietersiele, gekap == Metode: == ✔ Verhit die olie in ń kastrol en braai die yf en knoffel tot gekaramelliseer. Voeg die sampioene by en roerbraai 10min. ✔ Voeg die seldery, wortels en tiemie by en roerbraai nog ń paar minute. ✔ Sprinkel die meel oor en meng goed. ✔ Roer die gort en groenteaftreksel by, bring tot kookpunt en laat dit 40min. prut of tot die gort gaar is. ✔ Geur met die suurlemoensap,-skil, sout en peper. ✔ Roer die pietersiele deur en sit voor. jpoqjzx2ycf681l1lqwgquk7m9cpgqx Sampioen Sop 0 3417 7293 7120 2023-10-01T08:55:13Z Quinlan83 2343 Fix 7293 wikitext text/x-wiki [[File:Cream Mushroom soup 2.jpg|thumb]] '''''Afdeling''''': Sop resep '''''Bediening''''': 12 '''''Tyd''''': 1 uur == Bestanddele: == ⚫225g botter (verdeel) ⚫1 koppie meel (verdeel) ⚫12 koppies beesvleisaftreksel ⚫6 etl “extra-virgin olive oil” ⚫12 koppies gemengde sampioene (gesny) ⚫½ koppie sjerrie == Aanwysing: == Smelt die een helfte van die botter in ń groot pot oor matige hitte. Voeg ń ½ koppie van die meel by, roer aanhoudend tot dikkerig. Kook en roer aanhoudend vir 5minute tot ń liggeel sous. Voeg beesvleisaftreksel geleidelik by. Bring tot kookpunt terwyl jy roer. Verminder hitte en laat prut. In ń groot “saucepan” oor matige hitte, smelt die ander helte botter met die olyfolie. Gooi die gemengde sampioene by en roerbraai tot sag. Haal die pan van hitte af, gooi die res van die meel oor sampioene en roer liggies deur. Meng die sampioene met die beesvleisaftreksel sousmengsel. Roer die sjerrie by. Kook en roer af en toe totdat sop redelik verdik is. Bedien warm. f94mn7zmkr77jz8ieyr2nvn4rst2r58 Aartappel sop 2 0 3418 6997 2021-12-12T15:31:44Z Grigoz1 2342 Nuwe bladsy geskep met ' '''''Bedien''''': 8 '''''Tyd''''': 12 hours == Bestanddele: == 🔸5 medium aartappels, in blokke 🔸3 medium uie, gekap 🔸5 koppies water 🔸1 etl pietersiele 🔸1 seldery, gekap 🔸1 tlp sout 🔸swart peper na smaak 🔸4 koppies hoenderaftreksel 🔸4~5 etl botter 🔸1 blikkie ingedampte melk == Aanwysing: == In ń “slow cooker”, kombineer aartappels, uie, water, pietersiele, seldery, sout, peper, hoenderaftreksel en botter. Kook tot ga...' 6997 wikitext text/x-wiki '''''Bedien''''': 8 '''''Tyd''''': 12 hours == Bestanddele: == 🔸5 medium aartappels, in blokke 🔸3 medium uie, gekap 🔸5 koppies water 🔸1 etl pietersiele 🔸1 seldery, gekap 🔸1 tlp sout 🔸swart peper na smaak 🔸4 koppies hoenderaftreksel 🔸4~5 etl botter 🔸1 blikkie ingedampte melk == Aanwysing: == In ń “slow cooker”, kombineer aartappels, uie, water, pietersiele, seldery, sout, peper, hoenderaftreksel en botter. Kook tot gaar -- op lae hitte, 10~12 ure, of op hoë hitte, 3~4 ure. Wanneer klaar, voeg melk by en herverhit. Bedien netso of plaas in voedsel menger vir ń gladde sop. Herverhit indien nodig. f1fi4exxuz4pqmpes2oqn4h3m4d8bzc Aartappel slaai 0 3420 7114 7026 2021-12-21T15:10:32Z Grigoz1 2342 Foto bygevoeg 7114 wikitext text/x-wiki AARTAPPELSLAAI [[File:Potato salad (1).jpg]] ▶Kook aartappels tot gaar en sny in ringe of blokkies. == MAAK SOUS VAN: == 🔸Mayonaise, 🔸kondensmelk, 🔸bladjang, 🔸mosterd, 🔸sout, 🔸gemaalde swartpeper 🔸en bietjie Melk == Meng Die Volgende By: == 🔸My Aartappels 🔸1 groot ui fyngekap 🔸Groenpeper fyn gekap (opsioneel) 🔸3 Hardgekookte eiers in skywe gesny 🔸Pynappel stukke of jy kan ook die mousse gebruik (dreineer sap af) 🔸Agurkies fyngekap 🔸Blokkies kaas 🔸Gebraaide stukkies spek (opsioneel maar baie lekker) == Metode: == Meng dan alles lekker deur en bewaar in die yskas. Net voor jy dit opdien, meng weer lekker deur en sprinkel vars pietersielie en spruituie oor of gedroogde pietersielie. Die slaai is baie lekker as dit vir tenminste ‘n dag in die yskas gestaan het. == Wenk: == Sny jou aartappels in plat skywe, dan pak jy alles  in lae binne ‘n mooi glasbak en eindig af met die "crushed" pynappel en pietersielie. == nog ń Resep == AARTAPPELSLAAI '''Bestanddele''': 🔸8 medium aartappels in die vel 🔸5 ml sout 🔸knippie mosterdpoeier 🔸Suurlemoensap en swart peper na smaak 🔸½ k (125 ml) mayonnaise 🔸½ k (125 ml) gewone jogurt 🔸1 etl (15 ml) gekapte vars pietersielie 🔸½ groen of rooi soetrissie, sade verwyder en gekap 🔸½ ui, fyn gekap 🔸2 hardgekookte eiers, geskil en gekap (opsioneel) '''Metode''': »Plaas aartappels en ½ teelepel sout in ‘n pot met water. Bring tot kookpunt en kook tot sag. Laat afkoel, skil en sny in blokkies. »Meng  mosterd, die res van die sout, suurlemoensap, peper, mayonnaise, jogurt en pietersielie. »Meng sous in by  aartappels met soetrissie en ui. »Sprinkel met eier en bedien as ‘n bykos. l5w46pral1x7r3e0zy8qu5e4za16biz Boontjie slaai 0 3421 7014 7013 2021-12-12T23:51:11Z Grigoz1 2342 7014 wikitext text/x-wiki '''Boontjie Slaai''' == Slaai == '''Bestanddele:''' 🔸1×425 g Blik Boontjies in Tamatiesous 🔸1×410 g Blik Botter bone (Dreineer) 🔸1×420 g Blik Gewone Groenbone 🔸1 Green Pepper ontpit en gekap 🔸1 Groot ui gekap 🔸1 Hand vol rosyne of sultanas '''Metode:''' Gooi blikkies boontjies in glasbak dan ook “green pepper”, ui en rosyne. == Sous == '''Bestanddele:''' 🔸125 ml Asyn 🔸125 ml Olie 🔸125 ml Sagte Bruinsuiker '''Metode:''' Kook bestanddele vir sous vir 5 minute saam. Gooi sous oor slaaimengsel en meng goed. == Wenk: == Los in yskas vir ten minste 24 uur. Indien goed verseël kan die slaai vir 4 weke in yskas gebêre word. jexzjvs03w5miiwzcqrugqs4cdcueie Blomkool & broccoli slaai 0 3422 7035 7034 2021-12-13T20:22:37Z Grigoz1 2342 7035 wikitext text/x-wiki BLOMKOOL & BROKKOLI SLAAI == Bestanddele: == ⚫1 blomkool kop ⚫1 brokkoli kop ⚫1 ui, fyn gekap ⚫250 g spek stukkies ⚫150 g Cheddar, in klein blokkies gesny == Sous: == ⚫250 ml mayonnaise of ½ gewone joghurt en ½ mayo ⚫100 ml kondensmelk == Metode: == Breek die blomkool en brokkoli in stukkies en spoel dit af. Sny in kleiner stukkies. Kook die blomkool, brokkoli en ui in vinnig-kokende water vir 2 minute. Dreineer in ‘n vergiettes sodat al die water afloop. Braai die spek tot gaar en bros. Laat alles goed afkoel. Meng die brokkoli met die spek, en meng die kaasblokkies daarby in. Meng die mayonnaise en kondensmelk saam en roer dit deur die slaai. Verkoel voor opdiening. == Resep 2 == [[Broccoli en blomkool slaai]] 4unodjypyp2s0gtghphef5ejv3llany Ertjie-lagie slaai 0 3423 7020 7019 2021-12-13T10:36:24Z Grigoz1 2342 7020 wikitext text/x-wiki Hierdie resep het eintlik GEEN RESEP nodig nie – jy kan die slaai maak so groot of klein soos jy wil. Hier is ‘n aanduiding van hoeveel jy kan gebruik. == Bestanddele: == ★1 Blaarslaai – fyn opgekap en goed afgedroog ★1 blomkool – fyn opgekap ★1 ui – fyn opgekap ★2 stokkie seldery – fyn opgekap (ek het die gelos) ★1 Greenpepper – fyngekap ★500gr bevrore ertjies (gebruik net so gevries) ★2 kop mayonnaise ★250gr spek – bros gebraai (ek het sommer bacon-bits gebruik) ★Gerasperde kaas == Metode: == Begin deur die ½ de van die blaarslaai onder in die bak te pak. Gebruik alles helfte sodat jy 2 lae kan pak. Pak dan lagies ertjies gevolg deur al die ander bestanddele. Gooi 1 kop mayo oor. Begin weer lagies pak. Eindig af met die spek, kaas en mayo. Die slaai is heerlik as dit oornag staan. 7to4o5lcd7sahkmsvowueua8svdxp16 Gemengde groente slaai 0 3424 7022 2021-12-13T11:52:51Z Grigoz1 2342 Nuwe bladsy geskep met 'Hierdie GEMENGDE GROENTE SLAAI is baie eenvoudig. == Beslag: == <nowiki>*</nowiki> 1 Pak gemengde groente (net opgekook tot sag) <nowiki>*</nowiki> 1 Groot ui – gekap <nowiki>*</nowiki> Blokkies kaas <nowiki>*</nowiki> Mayonnaise na smaak <nowiki>*</nowiki> 2 eetl bladjang == Aanwysing: == Meng alles saam en bedien. Baie lekker ook as dit oornag staan.' 7022 wikitext text/x-wiki Hierdie GEMENGDE GROENTE SLAAI is baie eenvoudig. == Beslag: == <nowiki>*</nowiki> 1 Pak gemengde groente (net opgekook tot sag) <nowiki>*</nowiki> 1 Groot ui – gekap <nowiki>*</nowiki> Blokkies kaas <nowiki>*</nowiki> Mayonnaise na smaak <nowiki>*</nowiki> 2 eetl bladjang == Aanwysing: == Meng alles saam en bedien. Baie lekker ook as dit oornag staan. doqi9vs87fini1c8pw8c1g4ynvdg4jg Brokkoli slaai 0 3425 7028 2021-12-13T19:40:09Z Grigoz1 2342 Nuwe bladsy geskep met ' == Bestanddele: == 🔸Brokkoli (1 of 2 k en dit moet rou gebruik word) 🔸Kaas (soveel soos begeer en enige soort) 🔸Mayonaise (125 tot 500ml) 🔸Spek gebraai 🔸1 ui fyn gekap en gebraai 🔸1 pakkie sampioene fyn gesny en gebraai. == Aanwysing: == Meng alles saam en sit in die yskas tot afgekoel en dien op saam met ń lekker ete of sommer ook as n voorgereg.' 7028 wikitext text/x-wiki == Bestanddele: == 🔸Brokkoli (1 of 2 k en dit moet rou gebruik word) 🔸Kaas (soveel soos begeer en enige soort) 🔸Mayonaise (125 tot 500ml) 🔸Spek gebraai 🔸1 ui fyn gekap en gebraai 🔸1 pakkie sampioene fyn gesny en gebraai. == Aanwysing: == Meng alles saam en sit in die yskas tot afgekoel en dien op saam met ń lekker ete of sommer ook as n voorgereg. kkxj7lhitklww9gcpvv430vaost7tnn Broccoli en blomkool slaai 0 3426 7036 2021-12-13T20:28:52Z Grigoz1 2342 Nuwe bladsy geskep met 'BROKKOLI EN BLOMKOOL SLAAI == Bestanddele: == 🔼1 bossie broccoli en 1 bossie blomkool – sny in klein blommetjies 🔼1 pakkie spek, gesnipper en gebraai 🔼1 koppie rosyne 🔼1 koppie sonneblomsaad 🔼1 bossie slaai uie fyn gesny<sup>opsioneel</sup> 🔼1 blikkie pitmielies gedreineer 🔼1 koppie kaasblokkies == Slaaisous: == 🔽½ koppie asyn 🔽1 koppie conola olie 🔽1 koppie suiker 🔽1 teelepel sout 🔽1 teelepel mostertpoeier == Meto...' 7036 wikitext text/x-wiki BROKKOLI EN BLOMKOOL SLAAI == Bestanddele: == 🔼1 bossie broccoli en 1 bossie blomkool – sny in klein blommetjies 🔼1 pakkie spek, gesnipper en gebraai 🔼1 koppie rosyne 🔼1 koppie sonneblomsaad 🔼1 bossie slaai uie fyn gesny<sup>opsioneel</sup> 🔼1 blikkie pitmielies gedreineer 🔼1 koppie kaasblokkies == Slaaisous: == 🔽½ koppie asyn 🔽1 koppie conola olie 🔽1 koppie suiker 🔽1 teelepel sout 🔽1 teelepel mostertpoeier == Metode: == Meng al die slaaisous bestanddele goed saam. Meng al die slaai bestanddele, gooi die slaaisous oor en marineer in die yskas vir ‘n paar ure. a0127lwsfy66uzaogo44gqnkxp2kou9 Kerrie noedelslaai 0 3427 7039 7038 2021-12-13T20:56:09Z Grigoz1 2342 7039 wikitext text/x-wiki KERRIE NOEDELSLAAI == Bestanddele: == 500g klein skulpie noedels (gaar maar nie pap gekook) 1 green/yellow/red pepper gekap 1 ui gekap 1 na 2 wortels geskil en grof gerasper 1 blikkie pynappelstukke of perskes == Meng: == 1 kop tamatiesous ½ kop asyn ½ kop olie 200ml suiker 25ml Kerrie Sout en gemaalde swartpeper na smaak == Aanwysing: == Meng alles deur en hou in yskas.Hoe langer dit staan hoe lekkerder word die slaai. '''NB''' – Laat jou noedels heeltemal koud word voor jy die sous oorgooi – die rede hiervoor is – die warm noedels suig die sous op dan raak die slaai droog en die pasta is geneig om aanmekaar vas te klou. (dit is nou vir as jy dit oornag wil laat staan) 7xqd6010potf9gq4i1dnkr7x8qqdf6k Beskuitjies 0 3428 7132 7122 2021-12-21T23:42:40Z Grigoz1 2342 7132 wikitext text/x-wiki [[Cremora Koekies]] [[Hertzoggie]] [[Kaas en Uie Beskuitjies]] [[Klapper Koekies]] [[Koffiesoentjies]] [[Kondensmelk Koekies]] [[Oats Koekies]] [[Rice Krispie Koekies]] 5citzzbu11hic719cqccdx90194e97x Koek 0 3429 7354 7058 2023-12-07T05:14:34Z 94rain 2008 #redirect [[Amarula Koek]] 7354 wikitext text/x-wiki #redirect [[Amarula Koek]] a953yzeqp330m5wqbwt45hnpcjtmjd8 Amarula Koek 0 3430 7059 2021-12-17T23:14:04Z Grigoz1 2342 Nuwe bladsy geskep met 'AMARULA KOEK == Beslag: == 60 ml Kakao 125 ml kookwater 3 eiers 220 ml suiker 60 ml olie 250 ml koekmeel 10 ml bakpoeier 2 ml sout == Stroop: == 200 ml suiker 250 ml water 60 ml Amarula-likeur 1 blik karamelkondensmelk styf geklopte room en “flake”-sjokolade vir versiering. == Beslag metode: == Stel oond op 180°C. Meng kakao met kookwater en laat dit afkoel. Klits eiers, suiker en olie saam, voeg koue kakaomengsel by en meng deeglik. Sif die res...' 7059 wikitext text/x-wiki AMARULA KOEK == Beslag: == 60 ml Kakao 125 ml kookwater 3 eiers 220 ml suiker 60 ml olie 250 ml koekmeel 10 ml bakpoeier 2 ml sout == Stroop: == 200 ml suiker 250 ml water 60 ml Amarula-likeur 1 blik karamelkondensmelk styf geklopte room en “flake”-sjokolade vir versiering. == Beslag metode: == Stel oond op 180°C. Meng kakao met kookwater en laat dit afkoel. Klits eiers, suiker en olie saam, voeg koue kakaomengsel by en meng deeglik. Sif die res van droë bestanddele by en meng goed. Skep in 22cm×30cm pan en bak ongeveer 20 min. of tot toetspen skoon uitkom. == Stroop metode: == Kook suiker en water saam vir 5 minute en verwyder van stoof en voeg Amarula by. Roer goed. Prik koek met ‘n vurk sodra dit uit die oond kom en gooi warm stroop oor. == Versiering: == Laat goed koud word, verwyder uit pan, smeer karamelkondensmelk en styf geklopte room oor. Versier met “Flake" indien verkies (nie “Pepperment Crisp” nie, want dit belemmer die smaak). Dis ‘n heerlike klam koek/poeding wat lekker klam bly. == Wenk: == Ek maak myne sommer in ‘n “pyrex” bak en gooi die sous oor en smeer dan die kondensmelk oor en room. Sny in blokke en bedien. nh721doflxv6ovner46llbj96unclpa Koeke 0 3431 7117 7108 2021-12-21T15:52:53Z Grigoz1 2342 Boek uitgevee 7117 wikitext text/x-wiki [[Amarula Koek]] [[Fudge Koek]] snc2qqqs30ib9qdmehwboyy5cgl9hlp Poeding 0 3432 7074 7063 2021-12-18T00:56:35Z Grigoz1 2342 7074 wikitext text/x-wiki [[3 in 1 Gebakte Poeding]] [[Sjokola - koppie]] 31hnfwxiv6h9yi0scqjtkzyqeld3kr1 3 in 1 Gebakte Poeding 0 3433 7064 2021-12-17T23:53:53Z Grigoz1 2342 Nuwe bladsy geskep met '3 IN 1 GEBAKTE POEDING '''Grootte:''' Oondpan (ongeveer 25porsies) ''Die hoeveelhede tussen hakkies is vir 1 beslag.'' – '''Genoeg vir:''' 6~8 porsies == Beslag: == * 3 eiers (1 eier) * 1 ¼ k suiker (125ml suiker) * 3 k koekmeel (1k meel) * 3 tl bakpoeier (1tl bakpoeier) * 3 tl koeksoda (1tl koeksoda) * 90ml wit asyn (30ml asyn) * 6 etl appelkooskonfyt (2 etl appelkooskonfyt) * 3 k melk (1 kop melk) * 75 ml kakao poeier (25ml kakao) * ½ tl sout (knypie sout)...' 7064 wikitext text/x-wiki 3 IN 1 GEBAKTE POEDING '''Grootte:''' Oondpan (ongeveer 25porsies) ''Die hoeveelhede tussen hakkies is vir 1 beslag.'' – '''Genoeg vir:''' 6~8 porsies == Beslag: == * 3 eiers (1 eier) * 1 ¼ k suiker (125ml suiker) * 3 k koekmeel (1k meel) * 3 tl bakpoeier (1tl bakpoeier) * 3 tl koeksoda (1tl koeksoda) * 90ml wit asyn (30ml asyn) * 6 etl appelkooskonfyt (2 etl appelkooskonfyt) * 3 k melk (1 kop melk) * 75 ml kakao poeier (25ml kakao) * ½ tl sout (knypie sout) * 3 tl gerasperde lemoenskil (opsioneel) (1tl lemoenskil) == Metode: == Meng suiker en eiers. Gooi koeksoda in melk en los op. Meng al b.g. bestanddele en bak in oondpan vir ongeveer 45~50 minute of tot toetspen skoon uitkom by 180°C . Sit oond af. Haal uit, sny in blokke. Gooi die warm sous oor die poeding. Die sous lyk baie maar dit is nie. Gooi maar bietjie vir bietjie oor tot alles in die koek ingetrek het. Sit terug in oond vir ongeveer 10 min. == Sous: == * 3 k melk (of 2 k melk en 1 k room of 2 k melk en 1 kop idealmelk) (1 k melk of half half soos bo) * 3 k water (1 k water) * 1 ¼ k suiker (125ml/½k suiker) * 125gr botter (2 etl botter) * 15ml vanilje (5ml vanilje) * 75 ml kakao poeier (25ml kakao) * 3 tl gerasperde lemoenskil (opsioneel) (1tl lemoenskil) == Metode: == Bring alles tot kookpunt, en kook ‘n rukkie oor stadige hitte tot alles gesmelt is. == Wenk: == Los die lemoenskil uit as jy wil. Los die kakao uit vir gewone gebakte nagereg. Beslag kan met gemak verdeel word in 1 beslag (6~8 mense) of 2 (16 mense) Al die bestanddele is deelbaar deur 3. Bedien met vla of roomys of room. amgza9gwcwtjhdtwgaaapeh3p77sbrh Cremora Koekies 0 3434 7067 7066 2021-12-18T00:17:08Z Grigoz1 2342 7067 wikitext text/x-wiki CREMORA KOEKIES ==Bestanddele:== * 2 ½ koppies koekmeel * 1 koppie Nestle CREMORA * 1 el vla poeier * 1 tl. bakpoeier * 1 tl. sout * 1 kop regte botter, kamertemperatuur (baie sag) * 110g roomkaas, kamertemperatuur * 1 kop strooisuiker * 1 tl Vanielje geursel * 1 eier ==Metode:== Voorverhit die oond tot 170°C. '''Sif saam''': koekmeel, cremora, vla poeier, bakpoeier en sout, hou eenkant. Room die botter met roomkaas saam tot glad en romerig. Voeg die strooisuiker geleidelik by, terwyl jy aanhou meng. Vou die vanieljegeursel en eier by. Meng mooi deur tot gladde beslag Voeg nou die gesifte Cremora-mengsel geleidelik by, meng tot gladde beslag. Plaas in yskas vir 30 min. Gebruik jou hande en rol die beslag in klein balle en plaas dit op ‘n gesmeerde bakplaat en druk liggies in die middel met jou duim of met ‘n vurk. Pak die koekies ongeveer 2 cm uitmekaar. Bak 15 minute in die oond tot ligbruin. Laat die koekies afkoel op die plaat voordat dit na ‘n rak oorgeplaas word om heeltemal af te koel. 2rpplwcqikleij8rmghf8wvx3nyspvy Kaas en Uie Beskuitjies 0 3435 7069 2021-12-18T00:30:10Z Grigoz1 2342 Nuwe bladsy geskep met 'KAAS EN UIE BESKUITJIES == Bestanddele: == * 500ml koekmeel * 4ml sout * 2ml rooi peper as jy wil bietjie meer * 1pakkie wit uie sop * 6ml bakpoeier * 120ml “stork bake” * 300ml kaas gerasper * 2 eier gele * 100ml yswater. == Metode: == Voorverhit oond 190°C. Sif al die droë bestanddele behalwe uie sop in ń mengbak. Gooi dan soppoeier by, vryf botter met vingerpunte in meelnengsel en meng dan die kaas by. Klits eiergele ligies saam die water en go...' 7069 wikitext text/x-wiki KAAS EN UIE BESKUITJIES == Bestanddele: == * 500ml koekmeel * 4ml sout * 2ml rooi peper as jy wil bietjie meer * 1pakkie wit uie sop * 6ml bakpoeier * 120ml “stork bake” * 300ml kaas gerasper * 2 eier gele * 100ml yswater. == Metode: == Voorverhit oond 190°C. Sif al die droë bestanddele behalwe uie sop in ń mengbak. Gooi dan soppoeier by, vryf botter met vingerpunte in meelnengsel en meng dan die kaas by. Klits eiergele ligies saam die water en gooi oor die droe mengsel. Sny die vloeistof met n mes in die mengsel om n deeg te vorm. Verkoel vir 15min. Rol deeg uit en druk uit met koekie drukker en sny in vingers. Bak in voorverhitte oond vir 10 min, laat op bakplaat afkoel. 8ykq9ck16mvpuny5i8pwh3lvqlhcsz1 Kondensmelk Koekies 0 3436 7073 2021-12-18T00:51:48Z Grigoz1 2342 Nuwe bladsy geskep met 'KONDENSMELK KOEKIES == Bestanddele: == 700 g koekmeel 450 g botter 4 tl bakpoeier 1 blik kondensmelk 1 tl suurlemoengeursel 1 kop strooisuiker knypie sout. == Metode: == Voorverhit jou oond 190°C. Room jou botter en suiker tot romerig. Voeg blikkie kondensmelk by en meng goed deur. '''Sif saam''': meelblom, bakpoeier en sout en voeg by botter mengsel. Smeer bakplaat, skep teelepels vol op plaat Bak ongeveer 10~15 min.' 7073 wikitext text/x-wiki KONDENSMELK KOEKIES == Bestanddele: == 700 g koekmeel 450 g botter 4 tl bakpoeier 1 blik kondensmelk 1 tl suurlemoengeursel 1 kop strooisuiker knypie sout. == Metode: == Voorverhit jou oond 190°C. Room jou botter en suiker tot romerig. Voeg blikkie kondensmelk by en meng goed deur. '''Sif saam''': meelblom, bakpoeier en sout en voeg by botter mengsel. Smeer bakplaat, skep teelepels vol op plaat Bak ongeveer 10~15 min. nk6zazn01atmq48w9z1x611e49l4t9r Terte 0 3437 7137 7135 2021-12-22T01:16:56Z Grigoz1 2342 Nuwe titel 7137 wikitext text/x-wiki [[Aarbei Tert]] [[Banana-split Yskastert]] [[BarOne trifel]] [[Far Bretón]] [[Jogurt Tert]] [[Vla Tert]] 6npisdmxw26wnjh6xx6o27qxvbj10xg Aarbei Tert 0 3438 7078 7077 2021-12-18T01:18:38Z Grigoz1 2342 7078 wikitext text/x-wiki AARBEI VRIESKASKOEK == Bestanddele: == '''Vulsel:''' * 2 Koppies room * 2 eierwitte * ½ houertjie roomkaas (by kamertemperatuur) * 2 koppies vars aarbeie * ½ kop strooisuiker '''Kors''': * 1 pakkie tennisbeskuitjies (fyngerol) (hou so handvol krummels uit om bo-oor te strooi, meng bietjie klapper by vir ‘n variasie bo-op) * 100ml gesmelte botter == Metode: == Meng koekies en botter en druk vas in gespuite tertbak. Sny die aarbeie in stukkies. Klits die room styf – voeg die strooisuiker bietjies gewys by terwyl jy die room klits. Meng die roomkaas by. Klits die eierwitte tot stywe punte en vou dit in by die mengsel. Meng die aarbeie liggies in. Gooi bo-oor die tennisbeskuitjie kors. Sit gladwrap bo-oor en sit oornag in die vrieskas. Omtrent ‘n uur voor jy dit wil opdien, verwyder uit vrieskas, sny in blokke en laat dit dan effe ontdooi. Dit moet half gevries bedien word. == Wenk: == Druk jou mes in warm water terwyl jy die blokke sny. Indien jy nie vars aarbeie het nie, gebruik gebliktes wat goed gedreineeer is. fvdac7h3u8px0xfcs8psftut5k02nve BarOne trifel 0 3439 7267 7080 2023-07-23T09:28:51Z 160.226.137.24 7267 wikitext text/x-wiki BAR-ONE KOEKSTRUIF == Bestanddele: == * 1 pakkie (90 g) sjokolade kitspoeding * 400 ml melk * 125 g roomkaas * 250 ml (1 k) room, styf geklits * 1 pakkie (200 g) "Romany Creams," grof gebreek. * sjerrie vir oorsprinkel * 2 groot (100 g elk) "Bar-One" stafies, in blokkies gesny. == Metode: == »Klits die kitspoeding en melk saam tot dit net begin verdik. »Roer die roomkaas by die room in. »Sprinkel die helfte van die gebreekte koekies in ’n glasbak en besprinkel met die sjerrie. »Skep ’n laag sjokoladepoeding oor. »Skep ’n laag room oor en sprinkel van die sjokolade oor. »Herhaal die lae en rond af met stukkies Bar-One. »Plaas in die yskas tot stewig. 9n6ouw7oqk410zi3lqt76fgh8hq8qbi Banana-split Yskastert 0 3440 7269 7268 2023-07-23T09:33:53Z 160.226.137.24 /* Metode: */ 7269 wikitext text/x-wiki "BANANA SPLIT" YSKASTERT == Bestanddele: == * 1 Pakkie piesang kitspoeding (aangemaak met 2 koppies melk) * 250gr roomkaas (by kamertemperatuur) * ½ koppie versiersuiker * 250ml room * 2 pakkies tennisbeskuitjies * 500gr aarbeie * 1 Blikkie pynappelstukkies (goed gedreineer) * 10 na 12 kersies – gekap * Sjokolade en karamel sous * Gekapte neute == Metode: == Maak jou piesang kitspoeding aan met 3 koppies melk. Klits die roomkaas en versiersuiker tot gladde mengsel. Meng ½ koppie piesang poeding in by die roomkaasmengsel en meng goed deur. Klits die room tot styf. Meng ⅔ van die room in by die roomkaas mengsel. Begin deur ‘n lagie koekies onder in ‘n bak te pak. Smeer ½ van die roomkaas mengsel oor. Sny nou dun skyfies aarbeie en pak bo-op. Smeer nou ‘n lagie met die ½ van die piesang poeding oor. Pak weer ‘n lagie koekies. Smeer orige roomkaas mengsel oor. Gooi die pynappel en kersies oor. Gooi die laaste piesang poeding oor. Pak weer ‘n lagie koekies. Eindig af met die styfgeklopte room. Spuit nou nou die sjokolade en karamel oor met die neute. Sit in die yskas vir tenminste 4 ure of oornag. == Wenk: == Indien jy kleiner glasbak wil gebruik kan jy meer lae pak. Indien jy die sjokola en karamelsous wil los, strooi net neute en nog fyngemaakte tennisbeskuitjies oor. rmds0e44bm9x53n6dojxz6qztgkjn80 Jogurt Tert 0 3441 7086 2021-12-18T11:13:59Z Grigoz1 2342 Nuwe bladsy 7086 wikitext text/x-wiki JOGURT TERT Maklik, vinnig en goedkoop lekker tert!! == Beslag: == 🔹500 ml Jogurt (enige geur waarvan julle hou) 🔹1 blik kondensmelk 🔹1 pak Tennis beskuitjies 🔹botter == Doen so: == 1. Maak beskuitjies fyn vir kors en meng met gesmelte botter. 2. Meng jogurt en kondensmelk goed. 3. Gooi oor kors en sit in mikrogolfoond vir 4 min. op hoog. 4. Sit in yskas vir ± 1½ uur. 7mdz399yhyume8jr4wxobjk7n35vh83 Beskuitjie Sjokola Fudge 0 3442 7090 2021-12-18T11:50:15Z Grigoz1 2342 Nuwe bladsy 7090 wikitext text/x-wiki == Bestanddele: == 2 e Kakao 250 g margarien 500 g Versiersuiker 1 t Vanielje Geursel 1 pakkie Marie beskuitjies 1 eier == Metode: == Krummel beskuitjies en hou eenkant. Klits eier en geursel saam. Smelt Margarien oor lae hitte. Voeg kakao, versiersuiker, geklitste eier by. Verwyder kastrol van hitte en voeg gekrummelde beskuitjies by. Gooi in gesmeerde bak, laat koud word sny in blokkies en geniet. ngfqkmey15ry2kp87j1p46cmusaxe79 Fudge 1 0 3443 7094 2021-12-18T11:58:50Z Grigoz1 2342 Nuwe bladsy 7094 wikitext text/x-wiki FUDGE == Bestanddele: == 800 g suiker 250 g botter 250 ml melk 250 ml kondensmelk 10 ml vanielje 10 ml fyn kaneel == Metode: == Plaas al die bestanddele in ’n pot en bring tot kookpunt terwyl jy oor lae hitte met ’n houtlepel roer. Hou aan roer tot mengsel goudbruin kleur kry, sowat 25~30 minute. Verwyder van hitte en klits op lae spoed met elektriese handklitser tot mengsel romerig is. Spuit pan van 30×20 cm met kleefwerende kossproei en keer mengsel daarin uit. Laat afkoel tot koud en gestol. Keer uit op kapplank en sny fudge in 1,5×15 cm-skywe met ’n skerp mes. r1dzudgx5xac0eeeyekd5ghs89k113b BarOne fudge 0 3444 7096 2021-12-18T12:30:10Z Grigoz1 2342 Nuwe bladsy 7096 wikitext text/x-wiki BAR-ONE FUDGE == Bestanddele: == * 4× 60g Bar One stafies * 400g cadbury’s melksjokola blok * 395g blikkie kondensmelk * bietjie maizena vir sprinkel == Metode: == ✴Sprinkel ‘n 20cm vierkantige pan liggies met maizena. ✴Sny Bar One in stukke op. ✴Breek blok sjokola in blokkies. ✴Gooi die kondensmelk in ‘n medium kastrol, en oor lae hitte voeg die Cadbury’s melk sjokola – wat opgebreek is in blokkies by. ✴Bring kondensmelk en sjokola mengsel stadig tot kookpunt en roer gereeld totdat die sjokola gesmelt is. ✴Verwyder die kastrol van die plaat en voeg die gekapte Bar One stukke by en roer vinnig deur. ✴Gooi die fudge in die voorbereide pan en plaas in die yskas vir ‘n minimum van 6 uur (verkieslik oornag) sny dan in blokkies. ne5xkgjxa8obvrnhnf43dahbxijrgni Klapper Fudge 0 3445 7098 2021-12-18T12:41:13Z Grigoz1 2342 Nuwe bladsy 7098 wikitext text/x-wiki KLAPPER FUDGE == Bestanddele: == * 750ml (3k) suiker * 1ml (knypie) sout * 250ml (1k) room * 250ml (1k) klapper * 5 ml (1tl) vanilje == Metode: == Smelt en kook die 1ste 3 bestanddele tot glad – voeg by die klapper – Kook tot dik – voeg nou die vanilje by en roer goed deur. Gooi in platbak, Laat effe afkoel en sny in blokkies. ==Wenk:== Gekapte kersies en sommer grondboontjies (peanuts) fyngekap kan bygevoeg word. a7oypgukvgww9f2g1uxm8me4v83h38w Marie Beskuitjie Fudge 0 3446 7100 2021-12-18T12:49:08Z Grigoz1 2342 Nuwe bladsy 7100 wikitext text/x-wiki MARIE BESKUITJIE-FUDGE == Beslag: == * 1 Pak (200g) Marie beskuitjies (of enige ander lekker beskuitjies wat min of meer dieselfde is daar) * 250g margarien of botter * 1 pak (500g) versiersuiker (gesif) * 75 ml (5el)kakao, gesif * 1 eier == Metode: == Rol die beskuitjies met ‘n rolstok tot taamlik fyn, maar nie heeltemal fyn nie. Smelt die margarien in ‘n groot kastrol oor matige hitte en roer die versiersuiker en kakao by. Roer tot glad. Klop die eier vinnig by. Haal mengsel van die stoof af en roer die gekrummelde beskuitjies by. Skep in ‘n gesmeerde of met Spray ‘n Cook gespuite bak en laat afkoel. Sny in blokkies en bêre in yskas. 6w0snpdnpyvseif0904q07gbxd9eysg Neute Fudge 0 3447 7102 2021-12-18T12:56:42Z Grigoz1 2342 Nuwe bladsy 7102 wikitext text/x-wiki NEUTE FUDGE == Bestanddele: == * 5×250ml (5k) suiker * 125ml (0.5k) botter * 250ml (1k) melk * 25ml (1el + 2tl) gouestroop * Knypie sout * 1 blik kondensmelk * 5ml (1tl) vaniljegeursel * Gekapte neute * kersies(opsioneel) == Metode: == Plaas die eerste 5 bestanddele in ń kastrol roer met n houtlepel en ‘was’ al die suiker om die rante af. Sit die deksel op, verhit tot kookpunt en kook dit 5 minute lank stadig. Haal deksel af en roer die kondensmelk in. Roer goed totdat die mengsel weer kook. Kook die mengsel stadig tot goudbruin so 20~30 min. Laat effens afkoel en roer dan met houtlepel totdat die mengsel begin styf word. Voeg res van die bestanddele by versprei vinnig op ń gesmeerde bakplaat . Sny in blokkies voor heeltemal hard. Lewer 55 blokkies. lw8y56l6lobf7vpwpsra3ajw9mg1glv Sjokola Fudge 0 3448 7260 7104 2023-07-23T09:05:58Z 160.226.137.24 7260 wikitext text/x-wiki SKOJOLADE FUDGE == Bestanddele: == * 2×180g "milk chocolate slabs" * 60ml (4el) melk * 1½ koppie strooisuiker == Metode: == Smelt sjokolade en melk saam oor medium hitte. Klits strooisuiker goed by. Smeer gelyk in ń bakplaat so 1.5cm. Laat afkoel en set - sny in blokkies. ja4p629lv09n92ns4gtiexxbofel8nx Fudge Koek 0 3449 7107 2021-12-18T13:39:36Z Grigoz1 2342 Nuwe bladsy 7107 wikitext text/x-wiki FUDGE KOEK == Bestanddele: == * 1 ½ koppies suiker * ½ koppie kakao * 1 ½ teelepels koeksoda * 2 koppies meel * ¾ teelepel sout * 1 ½ teelepels vanielje * ¾ koppie olie * 1 ½ koppies water * 1 ½ teelepels wit asyn == Metode: == Oond 180°C. Pan grootte 9×3 (ongeveer 23cm) (Pan moet ongespuit wees)) Meng die nat bestanddele. Meng die droë bestanddele. Meng alles tot gladde mengsel. Bak vir 25 minute. Versier met jou keuse van versiersel bv. karamel, kondensmelk en klapper, geklopte room, ganache ens. Wees versigtig, die koek is baie klam so moenie te stywe versiersel probeer oorsmeer nie. loanhmqhr8n3a7bvf7m9hwzyspkk80n Klapper Koek 0 3450 7116 7115 2021-12-21T15:47:10Z Grigoz1 2342 Foto uitgevee 7116 wikitext text/x-wiki KLAPPERKOEK == Beslag: == * 3 kop koekmeelblom. * 300 ml witsuiker. * 1 kop klapper. * knypie sout. * 1 kop botter * 1 tl koeksoda. * 1 tl appelkooskonfyt. == Metode: == Voorverhit die oond tot 180°C. Sif droë bestanddele saam. Vryf die botter met vingerpunte in. Meng die koeksoda en appelkooskonfyt saam en sny in droë bestanddele in. Indien nodig, voeg ‘n klein bietjie melk by om stywe deeg te vorm. Vorm balletjies en plaas dit op ‘n bakplaat. Druk dit met ‘n vurk plat en versier met rooi en groen glanskersies. Bak vir ongeveer 10 minute tot ligbruin. sl2hdyumjdta4jvbuypf8nlvu9v7f5p Skommels 0 3451 7355 7111 2023-12-07T05:15:04Z 94rain 2008 #AANSTUUR [[Oreo Melkskommel]] 7355 wikitext text/x-wiki #AANSTUUR [[Oreo Melkskommel]] ldyu7skopntxn9snajiumx84affeuyf Oreo Melkskommel 0 3452 7112 2021-12-18T15:28:11Z Grigoz1 2342 Nuwe bladsy 7112 wikitext text/x-wiki OREO MELKSKOMMEL '''Bedien''': 1 tot 3, as jy voel om te deel. == Bestanddele: == * 2 koppies vanielje roomys * 1 koppie melk * 6~8 Oreo koekies == Metode: == Plaas roomys in ń glasbeker, voeg melk by. Roermeng met ń lepel tot glad. Breuk Oreos in verkiesde grootte stukkies. Gooi by melkskommel en meng goed deur. == Wenk: == Enige ander sjokola-koekie is ook van pas. Geklopte room (whipped cream) en "sprinkles" kan ook bygevoeg word. 33mld2qjfihtaxxlhos4dk3q9ttvano Klapper Koekies 0 3453 7123 2021-12-21T21:54:16Z Grigoz1 2342 Nuwe bladsy 7123 wikitext text/x-wiki '''Klapper koekies''' == Beslag: == 3 kop koekmeelblom. 300 ml witsuiker. 1 kop klapper. knypie sout. 1 kop botter 1 tl koeksoda. 1 tl appelkooskonfyt. == Metode: == Voorverhit die oond tot 180°C. Sif droë bestanddele saam. Vryf die botter met vingerpunte in. Meng die koeksoda en appelkooskonfyt saam en sny in droë bestanddele in. Indien nodig, voeg ‘n klein bietjie melk by om stywe deeg te vorm. Vorm balletjies en plaas dit op ‘n bakplaat. Druk dit met ‘n vurk plat en versier met rooi en groen glanskersies. Bak vir ongeveer 10 minute tot ligbruin. m8fhe7viavuzq81xl6aml3xhjtmcm6f Hertzoggie 0 3454 7134 7133 2021-12-21T23:52:34Z Grigoz1 2342 Kiekie bygevoeg 7134 wikitext text/x-wiki HERTZOGGIE [[File:Hertzoggies.jpg]] == Kors: == '''Bestanddele:''' * 250 g (445 ml) koekmeel * 10 ml bakpoeier * knippie sout * 125 g (135 ml) botter * 25 g (30 ml) strooisuiker * 3 eiergele * 15 ml water == Bolaag: == '''Bestanddele:''' * 1 blik 450 g All Gold Super Fine Apricot Jam oF All Gold Strawberry Jam * 3 eierwitte * 250 g (315 ml) suiker * 200 g (625 ml) fyn klapper == Metode: == Verhit jou oond tot 160°C. Sif die koekmeel, bakpoeier en sout saam. Vryf die botter in die meelmengsel tot dit soos broodkrummels lyk. Voeg die strooisuiker by en meng deur. Klits die eiergele en water saam. Voeg dit by die meelmengsel en maak aan tot ‘n deeg. Smeer ‘n bakplaat van sowat 30×23 cm goed met botter. Druk die deeg met jou hande in die bakplaat. Smeer die konfyt van jou keuse op die deeg. Klits die eierwitte styf. Voeg die suiker lepel vir lepel by tot jy ‘n stywe meringue het. Roer die klapper deur en sprei die meringue eweredig oor die konfyt. Bak vir 35~40 minute. Haal uit en sny in blokkies. Laat afkoel in die bakplaat voor jy die blokkies uithaal d6cjocczcls9iqezdg7s7maxzyq42m5 Vla Tert 0 3455 7352 7350 2023-12-07T05:13:25Z 94rain 2008 Wysigings deur [[Special:Contributions/Андрейкабах|Андрейкабах]] teruggerol na laaste weergawe deur [[User:Grigoz1|Grigoz1]] 7136 wikitext text/x-wiki '''Vla tert''' [[Lêer:CoconutCustardPie.jpg]] Hierdie is ń vertaalde weergawe. == Bestanddele: == * 2 koppies melk * ½ koppie meel (gesif) * ⅓ teelepel bakpoeier * 1 knypie sout * 3 eetlepels sagte botter * 4 groot eiers * ⅓ koppie suiker * 1 teelepel vanieljegeursel * klapper == Metode: == Meng al die bestanddele vir 1 minuut lank in ń ''blender''. Voer ń 25cm pastei plaat uit met botter en gooi die mengsel daarin. Bak vir 30 minute teen 200°C, of gebruik die toetspen. n8unq77ijug8vyvsepr1aw5p0wi8exf Far Bretón 0 3456 7140 7139 2021-12-22T01:53:35Z Grigoz1 2342 7140 wikitext text/x-wiki '''Far Bretón''' [[Lêer:Far-breton.jpg]] '''Far breton''' is 'n gewilde melktert wat in Bretagne warm as nagereg of koud as tert bedien word. Daar is baie variasies van die resep, maar die hoofbestanddele is tans gewoonlik meelblom, eiers, melk, suiker, droë vrugte (pruime), botter, vanielje en calvados of rum na smaak. == Bestanddele: == * 250 gram meelblom * 150 gram suiker * 4 eiers * 1 pakkie vanieljesuiker of vanieljegeursel * 1 liter melk * 100 gram droë vrugte (pruime; vars pruime of rosyntjies kan ewe goed gebruik word) * botter * 1 glasie calvados of rum na smaak * Kaneel na smaak == Metode: == Vermeng eers droë bestanddele (meelblom, suiker en vanieljesuiker). Voeg eiers by en klits saam (of skei eiers en voeg geklitste eiergele en geklitste eierwit apart by). Maak aan met melk en voeg calvados of rum na smaak by. Smeer botter in tertbak en plaas droë vrugte in die bak. Gooi deeg daaroor. Bak 45 tot 60 minute in voorverhitte oond by 175 °C tot 200 °C tot ligbruin en gaar. Strooi suiker en/of kaneel na smaak daaroor. dipha9ag35kg3pddmztsithy5rocnhp Oliebol 0 3457 7142 2021-12-22T19:54:57Z Grigoz1 2342 Nuwe bladsy 7142 wikitext text/x-wiki OLIEBOLLE [[Lêer:Oliebollen.jpg]] '''Lewer sowat 30 bolletjies.''' == Bestanddele: == '''Deeg/Oliebolle''' * 4×250ml koekmeelblom * 250ml suiker * 30ml bakpoeier * 2 eiers, geklop * 250~300ml water * 125ml rosyne * 750ml (om in te braai) '''Om in te rol:''' ''Meng-'' * 500ml suiker en * 30ml fyn kaneel == Metode: == * Meng meel, suiker en bakpoeier in ‘n mengbak. Klop eiers en water, voeg by meelmengsel en meng goed. Roer rosyne by. * Verhit die olie tot warm en skep elke keer ‘n eetlepel van die beslag in die warm olie. Braai bolletjies alkant tot goudbruin. * Moenie meer as 4 bolletjies gelyk braai nie. * Skep met ‘n gaatjieslepel in uit, dreineer oortollige olie en rol in kaneelsuiker. * Bedien. == Wenk: == Oliebolletjies moet nie lank gebêre word nie, want dit word gou sag. olgmf8unyirhguxb6elg5bd1sdsrzsm Gebruikerbespreking:QuiteUnusual 3 3458 7389 7147 2024-05-24T00:12:53Z Vít Karásek 2642 double redirect 7389 wikitext text/x-wiki #AANSTUUR [[meta:User talk:MarcGarver]] 16uehhmwvih1cl9k0mwkht8w7ypnfmg Gebruiker:QuiteUnusual/common.js 2 3459 7148 2021-12-23T10:10:18Z Ternarius 2354 Ternarius het bladsy [[Gebruiker:QuiteUnusual/common.js]] na [[Gebruiker:MarcGarver/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/QuiteUnusual|QuiteUnusual]]" to "[[Special:CentralAuth/MarcGarver|MarcGarver]]" 7148 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:MarcGarver/common.js\u0026action=raw\u0026ctype=text/javascript"); bd3t68ik3xrvpdm516euxdv3jec0607 Gebruiker:QuiteUnusual 2 3460 7150 2021-12-23T10:11:19Z Ternarius 2354 Ternarius het bladsy [[Gebruiker:QuiteUnusual]] na [[Gebruiker:MarcGarver]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/QuiteUnusual|QuiteUnusual]]" to "[[Special:CentralAuth/MarcGarver|MarcGarver]]" 7150 wikitext text/x-wiki #AANSTUUR [[Gebruiker:MarcGarver]] 0bdfz3ly9efipm2434kqd4gx36d54pu Gebruikerbespreking:Misbruikfilter 3 3461 7154 2022-01-04T18:10:11Z MediaWiki message delivery 1367 /* How we will see unregistered users */ nuwe afdeling 7154 wikitext text/x-wiki == How we will see unregistered users == <div lang="en" dir="ltr" class="mw-content-ltr"> <section begin=content/> Hi! You get this message because you are an admin on a Wikimedia wiki. When someone edits a Wikimedia wiki without being logged in today, we show their IP address. As you may already know, we will not be able to do this in the future. This is a decision by the Wikimedia Foundation Legal department, because norms and regulations for privacy online have changed. Instead of the IP we will show a masked identity. You as an admin '''will still be able to access the IP'''. There will also be a new user right for those who need to see the full IPs of unregistered users to fight vandalism, harassment and spam without being admins. Patrollers will also see part of the IP even without this user right. We are also working on [[m:IP Editing: Privacy Enhancement and Abuse Mitigation/Improving tools|better tools]] to help. If you have not seen it before, you can [[m:IP Editing: Privacy Enhancement and Abuse Mitigation|read more on Meta]]. If you want to make sure you don’t miss technical changes on the Wikimedia wikis, you can [[m:Global message delivery/Targets/Tech ambassadors|subscribe]] to [[m:Tech/News|the weekly technical newsletter]]. We have [[m:IP Editing: Privacy Enhancement and Abuse Mitigation#IP Masking Implementation Approaches (FAQ)|two suggested ways]] this identity could work. '''We would appreciate your feedback''' on which way you think would work best for you and your wiki, now and in the future. You can [[m:Talk:IP Editing: Privacy Enhancement and Abuse Mitigation|let us know on the talk page]]. You can write in your language. The suggestions were posted in October and we will decide after 17 January. Thank you. /[[m:User:Johan (WMF)|Johan (WMF)]]<section end=content/> </div> 18:10, 4 Januarie 2022 (UTC) <!-- Message sent by User:Johan (WMF)@metawiki using the list at https://meta.wikimedia.org/w/index.php?title=User:Johan_(WMF)/Target_lists/Admins2022(1)&oldid=22532492 --> f3aw1imuapjvxs2pg1m6d03le7iwxvf Gebruikerbespreking:Vit Koz 3 3462 7173 7160 2022-02-21T00:17:09Z EmausBot 1982 Robot: kapotte doorverwijzing gecorrigeerd door aanpassing naar hernoemde doelpagina [[Gebruikerbespreking:Brubaker610]] 7173 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Brubaker610]] gqhdz9892u2o0uh69mjlo40e0ijqn49 Gebruiker:Vit Koz 2 3463 7171 7161 2022-02-21T00:16:49Z EmausBot 1982 Robot: kapotte doorverwijzing gecorrigeerd door aanpassing naar hernoemde doelpagina [[Gebruiker:Brubaker610]] 7171 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Brubaker610]] 3mtpnuussog2gl3wbm2ff2tlocwlace Gebruikerbespreking:MdaNoman 3 3465 7198 7184 2022-09-25T06:37:37Z MdaNoman 2400 Not needed 7198 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruikerbespreking:মো. আব্দুল্লাহ আল নোমান 3 3468 7185 2022-06-25T19:02:30Z MdsShakil 2289 MdsShakil het bladsy [[Gebruikerbespreking:মো. আব্দুল্লাহ আল নোমান]] na [[Gebruikerbespreking:MdaNoman]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/মো. আব্দুল্লাহ আল নোমান|মো. আব্দুল্লাহ আল নোমান]]" to "[[Special:CentralAuth/MdaNoman|MdaNoman]]" 7185 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:MdaNoman]] pqr1k8c7apdrpa1ipsv3f0epzic1hj6 Gebruikerbespreking:Tulsi Bhagat 3 3469 7187 2022-07-09T03:41:42Z MdsShakil 2289 MdsShakil het bladsy [[Gebruikerbespreking:Tulsi Bhagat]] na [[Gebruikerbespreking:Tulsi]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Tulsi Bhagat|Tulsi Bhagat]]" to "[[Special:CentralAuth/Tulsi|Tulsi]]" 7187 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Tulsi]] erqchesb4rlkecu8rltnojnvaxuarma Gebruikerbespreking:MdsShakil/header 3 3470 7193 2022-08-06T16:03:37Z Pathoschild 29 create header for talk page ([[m:Synchbot|requested by MdsShakil]]) 7193 wikitext text/x-wiki <div style="display: flex; flex-wrap: wrap; justify-content: center; align-items: center; margin: 16px 0; border: 1px solid #aaaaaa;"> <div style="padding: 12px;">[[File:Circle-icons-megaphone.svg|75px|link=[[m:User_talk:MdsShakil]]]]</div> <div style="flex: 1; padding: 12px; background-color: #dddddd; color: #555555;"> <div style="font-weight: bold; font-size: 150%; color: red; font-family: 'Comic Sans MS'">Welcome to my talk page!</div> <div style="max-width: 700px">Hey! I am Shakil Hosen. I patrol many projects, and where I don't know the language I only act in cases of serious vandalism. If you think I have done anything wrong, feel free to [[m:User talk:MdsShakil|message me]] on Meta wiki. If you don't like that you can leave me messages here too, but since I do not watch all of my talk pages, your message might not get a timely response. Thanks! [[File:Face-smile.svg|18px|link=[[m:User:MdsShakil]]]]</div> </div> </div> 6ns6eellkw7iqc4yteyjnszfjmo2yio Gebruikerbespreking:MdsShakil 3 3471 7194 2022-08-06T17:43:14Z Pathoschild 29 add talk page header ([[m:Synchbot|requested by MdsShakil]]) 7194 wikitext text/x-wiki {{User talk:MdsShakil/header}} tbo8m2n1p4y1shpmyu07h1k0g9pq65d Gebruikerbespreking:Shinkiwa 3 3472 7200 2022-10-21T17:28:18Z QueerEcofeminist 2083 QueerEcofeminist het bladsy [[Gebruikerbespreking:Shinkiwa]] na [[Gebruikerbespreking:Sevht]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Shinkiwa|Shinkiwa]]" to "[[Special:CentralAuth/Sevht|Sevht]]" 7200 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Sevht]] 78i48b0r9qmzz4i0rrf3s1gvn8kgy1z Gebruikerbespreking:Adalhard Waffe 3 3473 7211 2022-12-19T01:19:18Z Superpes15 2196 Superpes15 het bladsy [[Gebruikerbespreking:Adalhard Waffe]] na [[Gebruikerbespreking:Adalhard]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adalhard Waffe|Adalhard Waffe]]" to "[[Special:CentralAuth/Adalhard|Adalhard]]" 7211 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Adalhard]] gc5j3as5u5ajq5y8f6b513vhf0ieavj Gebruikerbespreking:Gambler1478 3 3474 7222 2023-02-26T21:19:00Z Cabayi 2047 Cabayi het bladsy [[Gebruikerbespreking:Gambler1478]] na [[Gebruikerbespreking:Ertrinken]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Gambler1478|Gambler1478]]" to "[[Special:CentralAuth/Ertrinken|Ertrinken]]" 7222 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Ertrinken]] 9u28tlowt9l2aqddhy35toq1g2tlzbc Gebruiker:KernelFreeze/common.js 2 3475 7226 2023-03-11T10:32:26Z Taketa 1539 Taketa het bladsy [[Gebruiker:KernelFreeze/common.js]] na [[Gebruiker:Renamed user 9thz5duyuxms/common.js]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/KernelFreeze|KernelFreeze]]" to "[[Special:CentralAuth/Renamed user 9thz5duyuxms|Renamed user 9thz5duyuxms]]" 7226 javascript text/javascript /* #REDIRECT */mw.loader.load("//af.wikibooks.org/w/index.php?title=Gebruiker:Renamed_user_9thz5duyuxms/common.js\u0026action=raw\u0026ctype=text/javascript"); adwg6rqs4mmeqe5gxsraw595668dv2e Gebruiker:KernelFreeze 2 3476 7227 2023-03-11T10:32:26Z Taketa 1539 Taketa het bladsy [[Gebruiker:KernelFreeze]] na [[Gebruiker:Renamed user 9thz5duyuxms]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/KernelFreeze|KernelFreeze]]" to "[[Special:CentralAuth/Renamed user 9thz5duyuxms|Renamed user 9thz5duyuxms]]" 7227 wikitext text/x-wiki #AANSTUUR [[Gebruiker:Renamed user 9thz5duyuxms]] 68pwq5k51r675c5kv6q51s4syqns05c Kategorie:Bladsye met gebreekte lêer skakels 14 3479 7239 2023-05-01T13:15:39Z Ameisenigel 2070 Nuwe bladsy geskep met '__HIDDENCAT__' 7239 wikitext text/x-wiki __HIDDENCAT__ 2twjmejn56ditxo46hqinfh52nh6flb Gebruikerbespreking:K175 3 3547 7360 2023-12-17T22:12:30Z Cabayi 2047 Cabayi het bladsy [[Gebruikerbespreking:K175]] na [[Gebruikerbespreking:Pynappel]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/K175|K175]]" to "[[Special:CentralAuth/Pynappel|Pynappel]]" 7360 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Pynappel]] 9ydyuaii3d7t6wt3fof22y727sbdz1w Gebruikerbespreking:Vermont 3 3548 7366 7363 2023-12-31T18:06:44Z Wutsje 318 rv vandalisme 7366 wikitext text/x-wiki phoiac9h4m842xq45sp7s6u21eteeq1 Gebruiker:Stefán Örvar Sigmundsson 2 3550 7367 2024-01-01T15:51:13Z Stefán Örvar Sigmundsson 1864 Nuwe bladsy geskep met '[[wikipedia:en:User:Stefán Örvar Sigmundsson]]' 7367 wikitext text/x-wiki [[wikipedia:en:User:Stefán Örvar Sigmundsson]] eeyit5qujkn63fz4jizeeddlhkf4v7q Gebruiker:Adriaan 2 3551 7377 2024-05-01T18:20:30Z TenWhile6 2330 TenWhile6 het bladsy [[Gebruiker:Adriaan]] na [[Gebruiker:SunbeamDog]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adriaan|Adriaan]]" to "[[Special:CentralAuth/SunbeamDog|SunbeamDog]]" 7377 wikitext text/x-wiki #AANSTUUR [[Gebruiker:SunbeamDog]] cg1l6soqs3bqeoq77bc90wv134tc7cy Gebruikerbespreking:Adriaan 3 3552 7379 2024-05-01T18:20:30Z TenWhile6 2330 TenWhile6 het bladsy [[Gebruikerbespreking:Adriaan]] na [[Gebruikerbespreking:SunbeamDog]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/Adriaan|Adriaan]]" to "[[Special:CentralAuth/SunbeamDog|SunbeamDog]]" 7379 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:SunbeamDog]] 9ppau6s0c0jtiihilqc2ugl7qqtsy2w Gebruikerbespreking:User unavailable826 3 3553 7398 2024-07-10T09:18:48Z Nadzik 2199 Nadzik het bladsy [[Gebruikerbespreking:User unavailable826]] na [[Gebruikerbespreking:Anzx-ooo]] geskuif: Automatically moved page while renaming the user "[[Special:CentralAuth/User unavailable826|User unavailable826]]" to "[[Special:CentralAuth/Anzx-ooo|Anzx-ooo]]" 7398 wikitext text/x-wiki #AANSTUUR [[Gebruikerbespreking:Anzx-ooo]] 33920k5vvtqtfvrd7m1nw2jngy1b2qo